Stock Number Hs1387

Human Gene: LPXN


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
LPXN leupaxin HGNC:14061 11q12.1 Pax 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03618 pGW-HA.attB ENST00000395074.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166197384795

Sequences

DNA sequence (1392 bp) Protein sequence (464 aa)
ATGGAAGAGTTAGATGCCTTATTGGAGGAACTGGAACGCTCCACCCTTCA
GGACAGTGATGAATATTCCAACCCAGCTCCTCTTCCCCTGGATCAGCATT
CCAGAAAGGAGACTAACCTTGATGAGACTTCGGAGATCCTTTCTATTCAG
GATAACACAAGTCCCTTGCCGGCGCAGCTCGTGTATACTACCAATATCCA
GGAGCTCAATGTCTACAGTGAAGCCCAAGAGCCAAAGGAATCACCACCAC
CTTCTAAAACGTCAGCAGCTGCTCAGTTGGATGAGCTCATGGCTCACCTG
ACTGAGATGCAGGCCAAGGTTGCAGTGAGAGCAGATGCTGGCAAGAAGCA
CTTACCAGACAAGCAGGATCACAAGGCCTCCCTGGACTCAATGCTTGGGG
GTCTCGAGCAGGAATTGCAGGACCTTGGCATTGCCACAGTGCCCAAGGGC
CATTGTGCATCCTGCCAGAAACCGATTGCTGGGAAGGTGATCCATGCTCT
AGGGCAATCATGGCATCCTGAGCATTTTGTCTGTACTCATTGCAAAGAAG
AGATTGGCTCCAGTCCCTTCTTTGAGCGGAGTGGCTTGGCCTACTGCCCC
AACGACTACCACCAACTTTTTTCTCCACGCTGTGCTTACTGCGCTGCTCC
CATCCTGGATAAAGTGCTGACAGCAATGAACCAGACCTGGCACCCAGAGC
ACTTCTTCTGCTCTCACTGCGGAGAGGTGTTTGGTGCAGAAGGCTTTCAT
GAGAAGGACAAGAAGCCATATTGCCGAAAGGATTTCTTAGCCATGTTCTC
ACCCAAGTGTGGTGGCTGCAATCGCCCAGTGTTGGAAAACTACCTTTCAG
CCATGGACACTGTCTGGCACCCAGAGTGCTTTGTTTGTGGGGACTGCTTC
ACCAGTTTTTCTACTGGCTCCTTCTTTGAACTGGATGGACGTCCATTCTG
TGAGCTCCATTACCATCACCGCCGGGGAACGCTCTGCCATGGGTGTGGGC
AGCCCATCACTGGCCGTTGTATCAGTGCCATGGGGTACAAGTTCCATCCT
GAGCACTTTGTGTGTGCTTTCTGCCTGACACAGTTGTCGAAGGGCATTTT
CAGGGAGCAGAATGACAAGACCTATTGTCAACCTTGCTTCAATAAGCTCT
TCCCACTGTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCC
TATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGG
CGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTT
ACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGAC
TATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQ
DNTSPLPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHL
TEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKG
HCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCP
NDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFH
EKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCF
TSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHP
EHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPLYPTFLYKVVVPRSS
YSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPD
YAGSYPYDVPDYA*

Index