Stock Number Hs1385

Human Gene: SH3GLB2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SH3GLB2 SH3 domain containing GRB2 like, endophilin B2 HGNC:10834 9q34.11 EndoB 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03764 pGW-HA.attB ENST00000416629.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166197184794

Sequences

DNA sequence (1419 bp) Protein sequence (473 aa)
ATGGACTTCAACATGAAGAAGCTGGCGTCGGACGCGGGCATCTTCTTCAC
CCGGGCGGTGCAGTTCACGGAGGAGAAATTTGGCCAGGCTGAGAAGACTG
AGCTTGATGCCCACTTTGAAAACCTTCTGGCCCGGGCAGACAGCACCAAG
AACTGGACAGAGAAGATCTTGAGGCAGACAGAGGTGCTGCTGCAGCCCAA
CCCCAGTGCCCGAGTGGAGGAGTTCCTGTATGAGAAGCTGGACAGGAAGG
TCCCCTCAAGGGTCACCAACGGGGAGCTGCTGGCTCAGTACATGGCAGAC
GCGGCCAGTGAGCTGGGGCCGACCACCCCCTATGGGAAGACACTGATCAA
GGTGGCAGAAGCTGAAAAGCAACTGGGAGCCGCGGAGAGGGATTTTATCC
ACACGGCCTCCATCAGCTTCCTCACACCCTTGCGCAACTTCCTGGAGGGG
GACTGGAAGACCATCTCGAAGGAGAGGCGGCTCCTCCAAAACCGGCGTCT
GGACTTGGATGCCTGCAAAGCGAGGCTGAAGAAGGCCAAGGCTGCAGAAG
CCAAAGCCACGACGGTGCCTGACTTTCAGGAGACTAGACCTCGTAATTAC
ATTCTCTCGGCCAGCGCCTCCGCGCTCTGGAATGATGAAGTGGACAAGGC
CGAGCAGGAGCTCCGCGTGGCCCAGACAGAGTTTGACCGGCAAGCAGAAG
TGACCCGTCTCTTGCTGGAGGGAATCAGTAGCACTCACGTGAACCACCTG
CGCTGCCTCCACGAGTTCGTCAAGTCTCAGACAACCTACTACGCACAGTG
CTACCGCCACATGCTGGACTTGCAGAAGCAGCTGGGCAGATTTCCCGGCA
CCTTCGTGGGCACCACAGAGCCCGCCTCCCCACCCCTGAGCAGCACCTCA
CCCACCACTGCTGCGGCCACTATGCCTGTGGTGCCCTCTGTGGCCAGCCT
GGCCCCTCCAGGGGAGGCCTCGCTCTGCCTGGAAGAGGTGGCCCCCCCTG
CCAGTGGGACCCGCAAAGCTCGGGTGCTCTATGACTACGAGGCAGCCGAC
AGCAGTGAGCTGGCCCTGCTGGCTGATGAGCTCATCACTGTCTACAGCCT
GCCTGGCATGGACCCTGACTGGCTCATTGGCGAGAGAGGCAACAAGAAGG
GCAAGGTCCCTGTCACCTACTTGGAACTGCTCAGCTACCCAACTTTCTTG
TACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAAC
TTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTG
GAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTAT
GCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGA
CGTTCCAGATTACGCTTGA
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTK
NWTEKILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMAD
AASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEG
DWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNY
ILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHL
RCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTS
PTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAAD
SSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLSYPTFL
YKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDY
AGYPYDVPDYAGSYPYDVPDYA*

Index