Stock Number Hs1380

Human Gene: NKD2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
NKD2 naked cuticle homolog 2 HGNC:17046 5p15.33 nkd 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02656 pGW-HA.attB ENST00000274150.4 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166196684793

Sequences

DNA sequence (1167 bp) Protein sequence (389 aa)
ATGGGGAAACTGCAGTCGAAGCACGCCGCCGCCGCCCGCAAGCGGAGAGA
GAGCCCGGAAGGGGACAGCTTCGTGGCGTCCGCGTACGCGAGCGGCCGCA
AAGGCGCGGAGGAAGCGGAGCGGCGCGCGCGGGACAAGCAGGAGCTGCCC
AATGGGGACCCCAAGGAGGGGCCTTTCCGGGAGGACCAGTGTCCCCTACA
GGTGGCACTCCCCGCTGAGAAAGCTGAGGGCCGCGAGCACCCGGGACAAC
TCCTCAGCGCAGATGACGGAGAGAGGGCAGCAAACCGCGAGGGCCCGCGA
GGACCGGGCGGGCAGCGCCTCAACATTGACGCACTCCAGTGCGATGTCTC
GGTGGAGGAGGACGACCGCCAGGAGTGGACGTTCACGCTCTATGACTTTG
ACAACTGCGGGAAGGTCACCAGGGAGGACATGTCCAGCCTCATGCACACC
ATCTATGAGGTCGTGGATGCCTCGGTCAACCACTCCTCGGGCAGCAGCAA
GACCCTCCGTGTGAAGCTAACCGTCAGCCCTGAGCCCTCCAGCAAGAGGA
AGGAGGGTCCTCCTGCTGGCCAGGACCGGGAGCCCACCCGTTGCAGGATG
GAGGGTGAACTGGCAGAGGAGCCAAGGGTGGCTGACAGGAGGTTGTCTGC
ACACGTCAGGAGGCCCAGTACTGACCCCCAGCCCTGCTCGGAGCGGGGGC
CCTACTGCGTGGACGAGAACACGGAGCGCAGAAACCACTACCTGGACCTC
GCCGGGATTGAGAACTACACGTCCAGATTCGGCCCTGGGTCTCAGCTGTG
CGAGAAGAGAAGCTCCGCTCCCAGGACACACAGTGGGGACAAGGCTAGAG
GAGTCGGCCTTTGCAGGGAGCTGTGGAGCCAGGCAGGTCACCCACAGTGG
CCAGGCCCCTTCCCTTCAGGGCTGGTGGCCGTCTGCCCAACTTTCTTGTA
CAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTT
CCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGA
GCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGC
GGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACG
TTCCAGATTACGCTTGA
MGKLQSKHAAAARKRRESPEGDSFVASAYASGRKGAEEAERRARDKQELP
NGDPKEGPFREDQCPLQVALPAEKAEGREHPGQLLSADDGERAANREGPR
GPGGQRLNIDALQCDVSVEEDDRQEWTFTLYDFDNCGKVTREDMSSLMHT
IYEVVDASVNHSSGSSKTLRVKLTVSPEPSSKRKEGPPAGQDREPTRCRM
EGELAEEPRVADRRLSAHVRRPSTDPQPCSERGPYCVDENTERRNHYLDL
AGIENYTSRFGPGSQLCEKRSSAPRTHSGDKARGVGLCRELWSQAGHPQW
PGPFPSGLVAVCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGG
AGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index