Stock Number Hs1377

Human Gene: CA5B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CA5B carbonic anhydrase 5B HGNC:1378 Xp22.2 CAH1 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02686 pGW-HA.attB ENST00000454127.2 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166196384792

Sequences

DNA sequence (1185 bp) Protein sequence (395 aa)
ATGGTGGTGATGAACAGCCTGAGGGTCATTCTTCAAGCCTCTCCAGGCAA
ATTGCTGTGGAGAAAGTTCCAGATTCCGAGATTCATGCCAGCGAGGCCCT
GCAGCCTCTATACTTGTACTTACAAAACCCGGAACCGAGCCTTGCATCCA
CTCTGGGAGAGCGTGGACCTGGTTCCTGGGGGCGATCGCCAGTCACCCAT
CAACATTCGGTGGAGGGACAGTGTTTATGATCCCGGCTTAAAACCACTGA
CCATCTCTTATGACCCAGCCACCTGCCTCCACGTCTGGAATAATGGGTAC
TCTTTCCTCGTGGAATTTGAAGATTCTACAGATAAATCAGTGATCAAGGG
AGGACCCCTGGAACACAACTACCGATTGAAGCAGTTCCATTTTCACTGGG
GGGCCATCGATGCCTGGGGTTCTGAGCACACCGTGGACAGCAAATGCTTC
CCAGCAGAGCTGCACTTAGTGCATTGGAACGCAGTCAGATTTGAAAACTT
TGAGGATGCAGCACTGGAAGAAAATGGTTTGGCTGTGATAGGAGTATTTT
TAAAGCTAGGCAAACATCATAAGGAGCTACAGAAATTAGTGGATACTTTG
CCGTCAATTAAGCATAAGGACGCCCTTGTGGAATTTGGGTCATTTGACCC
TTCCTGCCTGATGCCTACCTGCCCAGATTACTGGACCTACTCAGGGTCTC
TGACTACCCCACCCCTCTCCGAGTCTGTCACCTGGATCATTAAGAAGCAA
CCAGTAGAGGTTGATCATGATCAGCTTGAGCAATTTCGGACCCTGCTTTT
CACTTCCGAAGGGGAGAAAGAGAAAAGAATGGTGGACAACTTCCGCCCCC
TTCAGCCACTGATGAATCGCACTGTTCGTTCATCCTTCCGGCATGATTAT
GTGCTGAATGTACAAGCGAAACCCAAGCCGGCCACCAGCCAAGCAACCCC
CTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTC
TACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCT
ACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATA
CGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAG
GATCCTATCCATATGACGTTCCAGATTACGCTTGA
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHP
LWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGY
SFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCF
PAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTL
PSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQ
PVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNVQAKPKPATSQATPYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGA
TAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index