Stock Number Hs1336

Human Gene: CASP3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CASP3 caspase 3 HGNC:1504 4q35.1 Drice 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02384 pGW-HA.attB ENST00000447121.2 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166192284791

Sequences

DNA sequence (1065 bp) Protein sequence (355 aa)
ATGGAGAACACTGAAAACTCAGTGGATTCAAAATCCATTAAAAATTTGGA
ACCAAAGATCATACATGGAAGCGAATCAATGGACTCTGGAATATCCCTGG
ACAACAGTTATAAAATGGATTATCCTGAGATGGGTTTATGTATAATAATT
AATAATAAGAATTTTCATAAAAGCACTGGAATGACATCTCGGTCTGGTAC
AGATGTCGATGCAGCAAACCTCAGGGAAACATTCAGAAACTTGAAATATG
AAGTCAGGAATAAAAATGATCTTACACGTGAAGAAATTGTGGAATTGATG
CGTGATGTTTCTAAAGAAGATCACAGCAAAAGGAGCAGTTTTGTTTGTGT
GCTTCTGAGCCATGGTGAAGAAGGAATAATTTTTGGAACAAATGGACCTG
TTGACCTGAAAAAAATAACAAACTTTTTCAGAGGGGATCGTTGTAGAAGT
CTAACTGGAAAACCCAAACTTTTCATTATTCAGGCCTGCCGTGGTACAGA
ACTGGACTGTGGCATTGAGACAGACAGTGGTGTTGATGATGACATGGCGT
GTCATAAAATACCAGTGGAGGCCGACTTCTTGTATGCATACTCCACAGCA
CCTGGTTATTATTCTTGGCGAAATTCAAAGGATGGCTCCTGGTTCATCCA
GTCGCTTTGTGCCATGCTGAAACAGTATGCCGACAAGCTTGAATTTATGC
ACATTCTTACCCGGGTTAACCGAAAGGTGGCAACAGAATTTGAGTCCTTT
TCCTTTGACGCTACTTTTCATGCAAAGAAACAGATTCCATGTATTGTTTC
CATGCTCACAAAAGAACTCTATTTTTATCACTACCCAACTTTCTTGTACA
AAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCC
ATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGC
CGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGG
GCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTT
CCAGATTACGCTTGA
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII
NNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELM
RDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRS
LTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTA
PGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESF
SFDATFHAKKQIPCIVSMLTKELYFYHYPTFLYKVVVPRSSYSLLSIGTS
ILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDV
PDYA*

Index