Stock Number Hs1323

Human Gene: GNA13


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
GNA13 G protein subunit alpha 13 HGNC:4381 17q24.1 cta 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03383 pGW-HA.attB ENST00000439174.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166190984790

Sequences

DNA sequence (1365 bp) Protein sequence (455 aa)
ATGGCGGACTTCCTGCCGTCGCGGTCCGTGCTGTCCGTGTGCTTCCCCGG
CTGCCTGCTGACGAGTGGCGAGGCCGAGCAGCAACGCAAGTCCAAGGAGA
TCGACAAATGCCTGTCTCGGGAAAAGACCTATGTGAAGCGGCTGGTGAAG
ATCCTGCTGCTGGGCGCGGGCGAGAGCGGCAAGTCCACCTTCCTGAAGCA
GATGCGGATCATCCACGGGCAGGACTTCGACCAGCGCGCGCGCGAGGAGT
TCCGCCCCACCATCTACAGCAACGTGATCAAAGGTATGAGGGTGCTGGTT
GATGCTCGAGAGAAGCTTCATATTCCCTGGGGAGACAACTCAAACCAACA
ACATGGAGATAAGATGATGTCGTTTGATACCCGGGCCCCCATGGCAGCCC
AAGGAATGGTGGAAACAAGGGTTTTCTTACAATATCTTCCTGCTATAAGA
GCATTATGGGCAGACAGCGGCATACAGAATGCCTATGACCGGCGTCGAGA
ATTTCAACTGGGTGAATCTGTAAAATATTTCCTGGATAACTTGGATAAAC
TTGGAGAACCAGATTATATTCCATCACAACAAGATATTCTGCTTGCCAGA
AGACCCACCAAAGGCATCCATGAATACGACTTTGAAATAAAAAATGTTCC
TTTCAAAATGGTTGATGTAGGTGGTCAGAGATCAGAAAGGAAACGTTGGT
TTGAATGTTTCGACAGTGTGACATCAATACTTTTCCTTGTTTCCTCAAGT
GAATTTGACCAGGTGCTTATGGAAGATCGACTGACCAATCGCCTTACAGA
GTCTCTGAACATTTTTGAAACAATCGTCAATAACCGGGTTTTCAGCAATG
TCTCCATAATTCTGTTCTTAAACAAGACAGACTTGCTTGAGGAGAAGGTG
CAAATTGTGAGCATCAAAGACTATTTCCTAGAATTTGAAGGGGATCCCCA
CTGCTTAAGAGACGTCCAAAAATTCCTGGTGGAATGTTTCCGGAACAAAC
GCCGGGACCAGCAACAGAAGCCCTTATACCACCACTTCACCACTGCTATC
AACACGGAGAACATCCGCCTTGTTTTCCGTGACGTGAAGGATACTATTCT
GCATGACAACCTCAAGCAGCTTATGCTACAGTGCCCAACTTTCTTGTACA
AAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCC
ATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGC
CGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGG
GCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTT
CCAGATTACGCTTGA
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVK
ILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLV
DAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIR
ALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLAR
RPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSS
EFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAI
NTENIRLVFRDVKDTILHDNLKQLMLQCPTFLYKVVVPRSSYSLLSIGTS
ILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDV
PDYA*

Index