Stock Number Hs1314

Human Gene: SMPDL3B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SMPDL3B sphingomyelin phosphodiesterase acid like 3B HGNC:21416 1p35.3 CG32052 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03361 pGW-HA.attB ENST00000373888.8 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166190084789

Sequences

DNA sequence (1353 bp) Protein sequence (451 aa)
ATGAGGCTGCTCGCCTGGCTGATTTTCCTGGCTAACTGGGGAGGTGCCAG
GGCTGAACCAGGGAAGTTCTGGCACATCGCTGACCTGCACCTTGACCCTG
ACTACAAGGTATCCAAAGACCCCTTCCAGGTGTGCCCATCAGCTGGATCC
CAGCCAGTGCCCGACGCAGGCCCCTGGGGTGACTACCTCTGTGATTCTCC
CTGGGCCCTCATCAACTCCTCCATCTATGCCATGAAGGAGATTGAGCCAG
AGCCAGACTTCATTCTCTGGACTGGTGATGACACGCCTCATGTGCCCGAT
GAGAAACTGGGAGAGGCAGCTGTACTGGAAATTGTGGAACGCCTGACCAA
GCTCATCAGAGAGGTCTTTCCAGATACTAAAGTCTATGCTGCTTTGGGAA
ATCATGATTTTCACCCCAAAAACCAGTTCCCAGCTGGAAGTAACAACATC
TACAATCAGATAGCAGAACTATGGAAACCCTGGCTTAGTAATGAGTCCAT
CGCTCTCTTCAAAAAAGGTGCCTTCTACTGTGAGAAGCTGCCGGGTCCCA
GCGGGGCTGGGCGAATTGTGGTCCTCAACACCAATCTGTACTATACCAGC
AATGCGCTGACAGCAGACATGGCGGACCCTGGCCAGCAGTTCCAGTGGCT
GGAAGATGTGCTGACCGATGCATCCAAAGCTGGGGACATGGTGTACATTG
TCGGCCACGTGCCCCCGGGGTTCTTTGAGAAGACGCAAAACAAGGCATGG
TTCCGGGAGGGCTTCAATGAAAAATACCTGAAGGTGGTCCGGAAGCATCA
TCGCGTCATAGCAGGGCAGTTCTTCGGGCACCACCACACCGACAGCTTTC
GGATGCTCTATGATGATGCAGGTGTCCCCATAAGCGCCATGTTCATCACA
CCTGGAGTCACCCCATGGAAAACCACATTACCTGGAGTGGTCAATGGGGC
CAACAATCCAGCCATCCGGGTGTTCGAATATGACCGAGCCACACTGAGCC
TGAAGGTCAGGAGTCCTGCGGAGGCCAGAGGAGGAGGGTGGGAGGGGCTT
AAATGCATCACCACCTTCCCTCACTCTCAGCTTATCCACCTTCCCCTGAC
CACTGAGCCTCAGGAAGGTTGCCCAACTTTCTTGTACAAAGTGGTGGTAC
CTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCT
CCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGC
GGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATG
ACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCT
TGA
MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGS
QPVPDAGPWGDYLCDSPWALINSSIYAMKEIEPEPDFILWTGDDTPHVPD
EKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDFHPKNQFPAGSNNI
YNQIAELWKPWLSNESIALFKKGAFYCEKLPGPSGAGRIVVLNTNLYYTS
NALTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKAW
FREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYDDAGVPISAMFIT
PGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGL
KCITTFPHSQLIHLPLTTEPQEGCPTFLYKVVVPRSSYSLLSIGTSILGA
PSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA
*

Index