Stock Number Hs1307

Human Gene: WNT1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
WNT1 Wnt family member 1 HGNC:12774 12q13.12 wg 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03341 pGW-HA.attB ENST00000293549.3 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166189384788

Sequences

DNA sequence (1344 bp) Protein sequence (448 aa)
ATGGGGCTCTGGGCGCTGTTGCCTGGCTGGGTTTCTGCTACGCTGCTGCT
GGCGCTGGCCGCTCTGCCCGCAGCCCTGGCTGCCAACAGCAGTGGCCGAT
GGTGGGGTATTGTGAACGTAGCCTCCTCCACGAACCTGCTTACAGACTCC
AAGAGTCTGCAACTGGTACTCGAGCCCAGTCTGCAGCTGTTGAGCCGCAA
ACAGCGGCGTCTGATACGCCAAAATCCGGGGATCCTGCACAGCGTGAGTG
GGGGGCTGCAGAGTGCCGTGCGCGAGTGCAAGTGGCAGTTCCGGAATCGC
CGCTGGAACTGTCCCACTGCTCCAGGGCCCCACCTCTTCGGCAAGATCGT
CAACCGAGGCTGTCGAGAAACGGCGTTTATCTTCGCTATCACCTCCGCCG
GGGTCACCCATTCGGTGGCGCGCTCCTGCTCAGAAGGTTCCATCGAATCC
TGCACGTGTGACTACCGGCGGCGCGGCCCCGGGGGCCCCGACTGGCACTG
GGGGGGCTGCAGCGACAACATTGACTTCGGCCGCCTCTTCGGCCGGGAGT
TCGTGGACTCCGGGGAGAAGGGGCGGGACCTGCGCTTCCTCATGAACCTT
CACAACAACGAGGCAGGCCGTACGACCGTATTCTCCGAGATGCGCCAGGA
GTGCAAGTGCCACGGGATGTCCGGCTCATGCACGGTGCGCACGTGCTGGA
TGCGGCTGCCCACGCTGCGCGCCGTGGGCGATGTGCTGCGCGACCGCTTC
GACGGCGCCTCGCGCGTCCTGTACGGCAACCGCGGCAGCAACCGCGCTTC
GCGGGCGGAGCTGCTGCGCCTGGAGCCGGAAGACCCGGCCCACAAACCGC
CCTCCCCCCACGACCTCGTCTACTTCGAGAAATCGCCCAACTTCTGCACG
TACAGCGGACGCCTGGGCACAGCAGGCACGGCAGGGCGCGCCTGTAACAG
CTCGTCGCCCGCGCTGGATGGCTGCGAGCTGCTCTGCTGCGGCAGGGGCC
ACCGCACGCGCACGCAGCGCGTCACCGAGCGCTGCAACTGCACCTTCCAC
TGGTGCTGCCACGTCAGCTGCCGCAACTGCACGCACACGCGCGTACTGCA
CGAGTGTCTGTTGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTT
CCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGA
GGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAAT
TTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGG
ACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDS
KSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNR
RWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIES
CTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNL
HNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRF
DGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFH
WCCHVSCRNCTHTRVLHECLLPTFLYKVVVPRSSYSLLSIGTSILGAPSG
GGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index