Stock Number Hs1303

Human Gene: VSX1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
VSX1 visual system homeobox 1 HGNC:12723 20p11.21 Vsx2 X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03324 pGW-HA.attB ENST00000376709.8 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166188984787

Sequences

DNA sequence (1329 bp) Protein sequence (443 aa)
ATGACCGGCCGGGACTCGCTTTCCGACGGGCGCACTAGCAGCAGGGCGCT
GGTGCCTGGCGGTTCCCCTAGGGGCTCGCGCCCCCGGGGCTTCGCCATCA
CGGACCTGCTGGGCTTGGAGGCCGAGCTGCCGGCGCCCGCTGGCCCAGGA
CAGGGATCTGGCTGCGAGGGTCCGGCAGTCGCGCCGTGCCCGGGCCCGGG
GCTTGACGGCTCCAGCCTGGCGCGTGGGGCCCTACCGCTGGGACTCGGCC
TCCTCTGTGGCTTCGGCACGCAGCCGCCGGCGGCCGCTCGAGCACCCTGC
CTGCTCCTAGCGGACGTGCCGTTCCTGCCGCCCAGGGGCCCCGAGCCCGC
TGCCCCGCTGGCTCCCAGCCGTCCGCCGCCTGCGCTCGGCCGCCAGAAGC
GCAGCGACAGCGTCTCCACGTCCGATGAGGACAGCCAGTCTGAAGACAGG
AATGACCTAAAGGCATCCCCCACCTTGGGCAAGAGGAAGAAGCGGCGGCA
CAGGACAGTTTTCACTGCTCACCAGCTGGAAGAGTTGGAGAAGGCATTCA
GCGAGGCCCACTACCCTGATGTGTATGCCCGAGAAATGCTGGCTGTGAAA
ACTGAGCTCCCCGAAGACCGGATACAGGTCTGGTTTCAAAACCGCAGGGC
CAAATGGCGCAAGCGGGAGAAGCGCTGGGGCGGCAGCAGCGTGATGGCCG
AGTACGGGCTGTACGGGGCCATGGTGCGCCACTGCATCCCGCTGCCAGAC
TCCGTGCTCAACTCCGCCGAGGGCGGCCTGCTGGGCTCCTGCGCGCCCTG
GCTCCTGGGGATGCATAAAAAATCCATGGGGATGATAAGGAAGCCAGGAA
GTGAAGATAAGTTGGCAGGACTCTGGGGCTCTGACCACTTCAAAGAAGGT
TCTAGCCAGAGTGAGTCAGGATCACAGAGAGGCTCAGATAAAGTGAGCCC
TGAGAATGGCTTGGAAGATGTGGCTATTGACCTCTCCAGCTCTGCCCGGC
AGGAGACCAAGAAAGTGCACCCTGGGGCTGGTGCTCAAGGAGGCTCCAAC
TCCACGGCACTGGAGGGGCCCCAGCCAGGGAAGGTGGGAGCCACATTGCC
AACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTA
GTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCT
GGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGT
TCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCT
ATCCATATGACGTTCCAGATTACGCTTGA
MTGRDSLSDGRTSSRALVPGGSPRGSRPRGFAITDLLGLEAELPAPAGPG
QGSGCEGPAVAPCPGPGLDGSSLARGALPLGLGLLCGFGTQPPAAARAPC
LLLADVPFLPPRGPEPAAPLAPSRPPPALGRQKRSDSVSTSDEDSQSEDR
NDLKASPTLGKRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVK
TELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCIPLPD
SVLNSAEGGLLGSCAPWLLGMHKKSMGMIRKPGSEDKLAGLWGSDHFKEG
SSQSESGSQRGSDKVSPENGLEDVAIDLSSSARQETKKVHPGAGAQGGSN
STALEGPQPGKVGATLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATA
GAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index