Stock Number Hs1295

Human Gene: BVES


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
BVES blood vessel epicardial substance HGNC:1152 6q21 bves X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03301 pGW-HA.attB ENST00000446408.2 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166188184786

Sequences

DNA sequence (1314 bp) Protein sequence (438 aa)
ATGAATTATACAGAGTCCAGCCCATTGAGAGAATCAACTGCCATAGGTTT
TACACCTGAGTTAGAAAGTATCATACCTGTGCCTTCCAATAAGACCACTT
GTGAAAACTGGAGAGAGATACATCATCTGGTTTTTCATGTAGCAAATATT
TGTTTTGCAGTTGGGTTGGTTATTCCAACTACTCTTCACCTTCATATGAT
ATTTCTTAGGGGAATGTTAACTCTAGGATGTACCCTTTATATCGTCTGGG
CCACTCTCTACCGATGTGCCTTGGATATAATGATCTGGAACTCTGTGTTC
TTGGGTGTCAACATTTTGCATCTGTCGTATCTTTTATACAAGAAGAGACC
GGTAAAGATTGAAAAGGAACTCAGTGGCATGTACCGGCGATTGTTTGAAC
CACTCCGTGTGCCTCCAGATTTGTTCAGAAGACTAACTGGACAGTTTTGC
ATGATCCAAACCTTGAAAAAGGGCCAAACTTATGCTGCAGAGGATAAAAC
CTCAGTTGATGACCGTCTGAGTATTCTCTTGAAGGGAAAAATGAAGGTCT
CCTATCGAGGACATTTTCTGCATAACATTTACCCCTGTGCCTTTATAGAT
TCTCCTGAATTTAGATCAACTCAGATGCACAAAGGTGAAAAATTCCAGGT
CACCATTATTGCAGATGATAACTGCAGATTTTTATGCTGGTCAAGAGAAA
GATTAACATACTTTCTGGAATCAGAACCTTTCTTGTATGAAATCTTTAGG
TATCTTATTGGAAAAGACATCACAAATAAGCTCTACTCATTGAATGATCC
CACCTTAAATGATAAAAAAGCCAAAAAGCTGGAACATCAGCTCAGCCTCT
GCACACAGATCTCCATGTTGGAAATGAGGAACAGTATAGCCAGCTCCAGT
GACAGTGACGACGGCTTGCACCAGTTTCTTCGGGGTACCTCCAGCATGTC
CTCTCTTCATGTGTCATCCCCACACCAGCGAGCCTCTGCCAAGATGAAAC
CGATAGAAGAAGGAGCAGAAGATGATGATGACGTTTTTGAACCGGCATCT
CCAAATACATTGAAAGTCCATCAGCTGCCTTGCCCAACTTTCTTGTACAA
AGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCA
TCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCC
GGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGG
CTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTC
CAGATTACGCTTGA
MNYTESSPLRESTAIGFTPELESIIPVPSNKTTCENWREIHHLVFHVANI
CFAVGLVIPTTLHLHMIFLRGMLTLGCTLYIVWATLYRCALDIMIWNSVF
LGVNILHLSYLLYKKRPVKIEKELSGMYRRLFEPLRVPPDLFRRLTGQFC
MIQTLKKGQTYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCAFID
SPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLESEPFLYEIFR
YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS
DSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPAS
PNTLKVHQLPCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGA
GGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index