Stock Number Hs1265

Human Gene: NRXN1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
NRXN1 neurexin 1 HGNC:8008 2p16.3 Nrx-1 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
GenScript G82053 NM004801_5 pGW-HA.attB NM004801_5 Reference N/a n/a Closed

Stocks

Docking Site DGRC BDSC FBti
VK37NO84785

Sequences

DNA sequence (4434 bp) Protein sequence (1478 aa)
ATGGGGACGGCGCTGCTCCAGCGCGGGGGCTGTTTTCTTCTGTGCCTCTC
GCTGCTGCTCCTGGGCTGCTGGGCGGAGCTGGGCAGCGGGCTGGAGTTTC
CGGGCGCCGAGGGCCAATGGACGCGCTTCCCCAAGTGGAACGCCTGCTGC
GAGAGCGAGATGAGCTTCCAGCTCAAGACTCGCAGCGCCCGCGGCCTCGT
GCTCTACTTCGACGACGAGGGCTTCTGCGACTTCCTGGAGCTGATTCTGA
CGCGCGGCGGCCGCCTGCAGCTCAGCTTCTCCATCTTCTGCGCTGAGCCT
GCGACGCTCCTGGCCGACACGCCGGTTAACGACGGCGCCTGGCACAGCGT
GCGCATCCGCCGCCAGTTCCGCAACACCACGCTCTTCATCGACCAGGTGG
AGGCCAAGTGGGTGGAGGTCAAGTCCAAGCGCAGGGACATGACGGTGTTC
AGCGGCCTTTTCGTCGGGGGGCTGCCCCCGGAACTGCGCGCCGCGGCGCT
CAAGCTCACCCTGGCCTCGGTGAGGGAGCGGGAGCCCTTCAAGGGGTGGA
TTCGTGACGTGAGGGTCAACTCCTCGCAGGTCCTGCCCGTGGACAGCGGC
GAGGTGAAGCTGGACGATGAGCCGCCCAACAGCGGCGGGGGAAGCCCGTG
CGAGGCGGGCGAGGAGGGCGAGGGCGGGGTGTGCCTCAACGGAGGTGTGT
GCTCCGTGGTGGACGACCAGGCCGTGTGCGACTGCTCGCGAACCGGCTTC
CGCGGCAAGGACTGCAGCCAAGAAGACAACAATGTGGAAGGTCTGGCGCA
CCTGATGATGGGCGACCAAGGTAAAAGTAAAGGAAAAGAAGAATATATTG
CCACGTTCAAAGGATCTGAATACTTCTGCTACGACTTGTCTCAAAACCCC
ATTCAAAGCAGCAGTGATGAAATAACTCTGTCATTTAAAACCCTTCAGAG
GAATGGACTGATGCTTCACACTGGGAAATCGGCTGATTATGTCAATCTTG
CCCTGAAAAATGGAGCTGTCTCTCTGGTCATTAATTTGGGATCAGGGGCC
TTTGAAGCACTAGTGGAGCCTGTGAATGGAAAGTTTAATGATAATGCCTG
GCATGATGTGAAAGTCACCAGGAATCTGCGTCAGCACTCAGGCATTGGAC
ACGCTATGGTGACAATATCAGTGGATGGGATTCTTACCACAACGGGCTAC
ACGCAAGAAGATTATACCATGCTGGGGTCTGATGACTTTTTCTATGTTGG
AGGCAGTCCCAGCACAGCCGACCTTCCAGGGTCACCAGTCAGTAACAACT
TTATGGGCTGTCTCAAAGAGGTTGTATATAAAAATAATGATGTGAGGCTG
GAATTATCTCGACTTGCCAAGCAAGGAGATCCTAAGATGAAGATCCATGG
AGTGGTGGCATTTAAATGTGAGAATGTTGCAACTTTAGACCCAATCACCT
TTGAAACCCCAGAGTCTTTCATCTCTTTGCCTAAATGGAATGCAAAGAAA
ACTGGCTCCATATCATTTGATTTCCGTACAACAGAGCCAAATGGCCTCAT
CTTATTTAGCCATGGCAAGCCAAGACATCAGAAAGATGCCAAGCACCCAC
AGATGATAAAGGTGGACTTCTTTGCTATTGAGATGCTAGATGGCCACCTC
TACCTCCTCCTGGACATGGGGTCAGGTACTATAAAAATAAAAGCCCTGTT
GAAGAAAGTGAATGATGGAGAATGGTATCATGTGGACTTCCAGAGAGACG
GACGGTCAGGTACCATTTCTGTCAACACGTTGCGTACTCCCTACACTGCT
CCTGGTGAGAGTGAGATTCTGGACCTGGATGATGAGTTGTACCTGGGGGG
GCTGCCAGAAAATAAAGCTGGCCTTGTCTTCCCCACCGAGGTGTGGACTG
CTCTGCTCAACTATGGCTACGTGGGCTGCATCAGGGATTTGTTCATCGAT
GGCCAAAGCAAAGATATCCGGCAAATGGCTGAAGTTCAAAGTACTGCTGG
AGTGAAGCCTTCCTGCTCAAAGGAAACAGCAAAACCGTGCCTTAGCAACC
CTTGCAAAAACAATGGCATGTGCAGGGATGGGTGGAACAGATATGTCTGT
GATTGTTCCGGAACAGGCTATCTTGGCAGGTCCTGTGAGAGAGAGGCAAC
GGTTTTGAGCTATGATGGGAGCATGTTTATGAAAATTCAGCTCCCCGTAG
TCATGCATACGGAGGCTGAGGATGTTTCCTTACGGTTCCGATCCCAGCGT
GCATATGGCATTCTGATGGCAACCACTTCTAGAGACTCTGCTGACACCCT
CCGCCTGGAGCTAGACGCAGGACGTGTGAAACTGACGGTCAATCTAGATT
GTATCAGGATTAACTGTAATTCCAGCAAAGGTCCCGAGACTCTTTTTGCT
GGCTATAACCTCAATGATAACGAGTGGCACACAGTGCGTGTAGTTCGGCG
TGGAAAAAGTTTAAAGTTAACAGTGGATGACCAACAGGCCATGACAGGTC
AAATGGCAGGTGATCATACTAGGCTGGAGTTCCATAACATAGAGACTGGC
ATCATCACAGAACGACGGTATCTTTCTTCTGTCCCCTCCAACTTCATTGG
ACACCTGCAGAGCTTGACATTTAATGGAATGGCATACATTGACCTGTGTA
AAAATGGCGACATAGATTACTGTGAGCTTAATGCCAGATTTGGCTTCAGG
AACATCATAGCAGATCCTGTCACCTTCAAGACCAAATCGAGCTATGTTGC
CTTAGCTACCTTGCAAGCCTACACTTCTATGCATCTTTTTTTCCAGTTCA
AGACAACATCCCTAGATGGATTAATTCTATATAACAGTGGGGATGGAAAT
GACTTTATTGTGGTTGAATTAGTTAAAGGGTACTTACATTACGTGTTTGA
TTTGGGAAATGGTGCTAACCTCATCAAAGGAAGCTCAAATAAACCTCTCA
ATGACAATCAGTGGCACAACGTGATGATATCAAGGGACACCAGCAACCTC
CACACTGTAAAGATTGACACAAAAATCACAACGCAAATCACCGCCGGAGC
CAGGAACTTAGACCTCAAGAGTGACTTATATATAGGAGGAGTAGCTAAAG
AAACATACAAATCCTTACCAAAACTTGTACATGCCAAAGAAGGCTTTCAA
GGCTGCCTGGCATCAGTTGATTTAAATGGACGGCTTCCGGACCTCATCTC
CGATGCTCTTTTCTGCAACGGACAGATCGAGAGAGGATGTGAAGGGCCCA
GCACAACCTGCCAAGAGGACTCATGTTCCAATCAAGGTGTGTGCTTGCAA
CAATGGGATGGCTTCAGCTGTGACTGTAGTATGACTTCCTTCAGTGGACC
ACTCTGCAATGACCCTGGGACGACATATATCTTTAGCAAAGGTGGTGGAC
AAATCACGTATAAGTGGCCTCCTAATGACCGACCCAGTACACGAGCAGAC
AGACTGGCCATAGGTTTTAGCACTGTTCAGAAAGAAGCCGTATTGGTGCG
AGTGGACAGTTCTTCAGGCTTGGGTGACTACCTAGAACTGCATATACACC
AGGGAAAAATTGGAGTTAAGTTTAATGTTGGGACAGATGACATCGCCATT
GAAGAATCCAATGCAATCATTAATGATGGGAAATACCATGTAGTTCGTTT
CACGAGGAGTGGTGGCAATGCCACGTTGCAGGTGGACAGCTGGCCAGTGA
TCGAGCGCTACCCTGCAGGGCGTCAGCTCACAATCTTCAATAGCCAAGCA
ACCATAATAATTGGCGGGAAAGAGCAGGGCCAGCCCTTCCAGGGCCAGCT
CTCTGGGCTGTACTACAATGGCTTGAAAGTTCTGAATATGGCAGCCGAAA
ACGATGCCAACATCGCCATAGTGGGAAATGTGAGACTGGTTGGTGAAGTG
CCTTCCTCTATGACAACTGAGTCAACAGCCACTGCCATGCAATCAGAGAT
GTCCACATCAATTATGGAGACTACCACGACCCTGGCTACTAGCACAGCCA
GAAGAGGAAAGCCCCCGACAAAAGAACCCATTAGCCAGACCACAGATGAC
ATCCTTGTGGCCTCAGCAGAGTGTCCCAGCGATGATGAGGACATTGACCC
CTGTGAGCCGAGCTCAGGTGGGTTAGCCAACCCAACCCGAGCAGGCGGCA
GAGAGCCGTATCCAGGCTCAGCAGAAGTGATCCGGGAGTCCAGCAGCACC
ACGGGTATGGTCGTTGGGATAGTAGCCGCTGCCGCCCTGTGCATCCTTAT
CCTCCTCTATGCCATGTACAAGTACAGAAACCGGGATGAAGGCTCATACC
ATGTGGACGAGAGTCGAAACTACATCAGTAACTCAGCACAGTCCAATGGG
GCTGTTGTAAAGGAGAAACAACCCAGCAGTGCGAAAAGCTCCAACAAAAA
TAAGAAAAACAAGGATAAAGAGTATTATGTCTGA
MGTALLQRGGCFLLCLSLLLLGCWAELGSGLEFPGAEGQWTRFPKWNACC
ESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEP
ATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKWVEVKSKRRDMTVF
SGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSG
EVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGF
RGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNP
IQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGA
FEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGY
TQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRL
ELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKK
TGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHL
YLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTA
PGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFID
GQSKDIRQMAEVQSTAGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVC
DCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQR
AYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFA
GYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETG
IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFR
NIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGN
DFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNL
HTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQ
GCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQ
QWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRAD
RLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAI
EESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQA
TIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEV
PSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDD
ILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSST
TGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNG
AVVKEKQPSSAKSSNKNKKNKDKEYYV*

Index