Stock Number Hs1241

Human Gene: CDKL5


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CDKL5 Cyclin Dependent Kinase Like 5 HGNC:11411 Xp22.13 CG7236 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection IOH82159 pGW-HA.attB NM_001037343.1 Reference Closed

Stocks

Docking Site DGRC BDSC FBti
VK33NO84784

Sequences

DNA sequence (3093 bp) Protein sequence (1031 aa)
ATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGG
GGTTGTAGGTGAAGGAGCCTATGGAGTTGTACTTAAATGCAGACACAAGG
AAACACATGAAATTGTGGCGATCAAGAAATTCAAGGACAGTGAAGAAAAT
GAAGAAGTCAAAGAAACGACTTTACGAGAGCTTAAAATGCTTCGGACTCT
CAAGCAGGAAAACATTGTGGAGTTGAAGGAAGCATTTCGTCGGAGGGGAA
AGTTGTACTTGGTGTTTGAGTATGTTGAAAAAAATATGCTCGAATTGCTG
GAAGAAATGCCAAATGGAGTTCCACCTGAGAAAGTAAAAAGCTACATCTA
TCAGCTAATCAAGGCTATTCACTGGTGCCATAAGAATGATATTGTCCATC
GAGATATAAAACCAGAAAATCTCTTAATCAGCCACAATGATGTCCTAAAA
CTGTGTGACTTTGGTTTTGCTCGTAATCTGTCAGAAGGCAATAATGCTAA
TTACACAGAGTACGTTGCCACCAGATGGTATCGGTCCCCAGAACTCTTAC
TTGGCGCTCCCTATGGAAAGTCCGTGGACATGTGGTCGGTGGGCTGTATT
CTTGGGGAGCTTAGCGATGGACAGCCTTTATTTCCTGGAGAAAGTGAAAT
TGACCAACTTTTTACTATTCAGAAGGTGCTAGGACCACTTCCATCTGAGC
AGATGAAGCTTTTCTACAGTAATCCTCGCTTCCATGGGCTCCGGTTTCCA
GCTGTTAACCATCCTCAGTCCTTGGAAAGAAGATACCTTGGAATTTTGAA
TAGTGTTCTACTTGACCTAATGAAGAATTTACTGAAGTTGGACCCAGCTG
ACAGATACTTGACAGAACAGTGTTTGAATCACCCTACATTTCAAACCCAG
AGACTTCTGGATCGTTCTCCTTCAAGGTCAGCAAAAAGAAAACCTTACCA
TGTGGAAAGCAGCACATTGTCTAATAGAAACCAAGCCGGCAAAAGTACTG
CTTTGCAGTCTCACCACAGATCTAACAGCAAGGACATCCAGAACCTGAGT
GTAGGCCTGCCCCGGGCTGACGAAGGTCTCCCTGCCAATGAAAGCTTCCT
AAATGGAAACCTTGCTGGAGCTAGTCTTAGTCCACTGCACACCAAAACCT
ACCAAGCAAGCAGCCAGCCTGGGTCTACCAGCAAAGATCTCACCAACAAC
AACATACCACACCTTCTTAGCCCAAAAGAAGCCAAGTCAAAAACAGAGTT
TGATTTTAATATTGACCCAAAGCCTTCAGAAGGCCCAGGGACAAAGTACC
TCAAGTCAAACAGCAGATCTCAGCAGAACCGCCACTCATTCATGGAAAGC
TCTCAAAGCAAAGCTGGGACACTGCAGCCCAATGAAAAGCAGAGTCGGCA
TAGCTATATTGACACAATTCCCCAGTCCTCTAGGAGTCCCTCCTACAGGA
CCAAGGCCAAAAGCCATGGGGCACTGAGTGACTCCAAGTCTGTGAGCAAC
CTTTCTGAAGCCAGGGCCCAAATTGCGGAGCCCAGTACCAGTAGGTACTT
CCCATCTAGCTGCTTAGACTTGAATTCTCCCACCAGCCCAACCCCCACCA
GACACAGTGACACGAGAACTTTGCTCAGCCCTTCTGGAAGAAATAACCGA
AATGAGGGAACGCTGGACTCACGTCGAACCACAACCAGACATTCTAAGAC
GATGGAGGAATTGAAGCTGCCGGAGCACATGGACAGTAGCCATTCCCATT
CACTGTCTGCACCTCACGAATCTTTTTCTTATGGACTGGGCTACACCAGC
CCCTTTTCTTCCCAGCAACGTCCTCATAGGCATTCTATGTATGTGACCCG
TGACAAAGTGAGAGCCAAGGGCTTGGATGGAAGCTTGAGCATAGGGCAAG
GGATGGCAGCTAGAGCCAACAGCCTGCAACTCTTGTCACCCCAGCCTGGA
GAACAGCTCCCTCCAGAGATGACTGTGGCAAGATCTTCGGTCAAAGAGAC
CTCCAGAGAAGGCACCTCTTCCTTCCATACACGCCAGAAGTCTGAGGGTG
GAGTGTATCATGACCCACACTCTGATGATGGCACAGCCCCCAAAGAAAAT
AGACACCTATACAATGATCCTGTGCCAAGGAGAGTTGGTAGCTTTTACAG
AGTGCCATCTCCACGTCCAGACAATTCTTTCCATGAAAATAATGTGTCAA
CTAGAGTTTCTTCTCTACCATCAGAGAGCAGTTCTGGAACCAACCACTCA
AAAAGACAACCAGCATTCGATCCATGGAAAAGTCCTGAAAATATTAGTCA
TTCAGAGCAACTCAAGGAAAAAGAGAAGCAAGGATTTTTCAGGTCAATGA
AAAAGAAAAAGAAGAAATCTCAAACAGTACCCAATTCCGACAGCCCTGAT
CTTCTGACGTTGCAGAAATCCATTCATTCTGCTAGCACTCCAAGCAGCAG
ACCAAAGGAGTGGCGCCCCGAGAAGATCTCAGATCTGCAGACCCAAAGCC
AGCCATTAAAATCACTGCGCAAGTTGTTACATCTCTCTTCGGCCTCAAAT
CACCCGGCTTCCTCAGATCCCCGCTTCCAGCCCTTAACAGCTCAACAAAC
CAAAAATTCCTTCTCAGAAATTCGGATTCACCCCCTGAGCCAGGCCTCTG
GCGGGAGCAGCAACATCCGGCAGGAACCCGCACCGAAGGGCAGGCCAGCC
CTCCAGCTGCCAGACGGTGGATGTGATGGCAGAAGACAGAGACACCATTC
TGGACCCCAAGATAGACGCTTCATGTTAAGGACGACAGAACAACAAGGAG
AATACTTCTGCTGTGGTGACCCAAAGAAGCCTCACACTCCGTGCGTCCCA
AACCGAGCCCTTCATCGTCCAATCTCCAGTCCTGCTCCCTATCCAGTACT
CCAGGTCCGAGGCACTTCCATGTGCCCGACACTCCAGGTCCGAGGCACTG
ATGCTTTCAGCTGCCCAACCCAGCAATCCGGGTTCTCTTTCTTCGTGAGA
CACGTTATGAGGGAAGCCCTGATTCACAGGGCCCAGGTAAACCAAGCTGC
GCTCCTGACATACCATGAGAATGCGGCACTGACGGGCAAGTGA
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEEN
EEVKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELL
EEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLK
LCDFGFARNLSEGNNANYTEYVATRWYRSPELLLGAPYGKSVDMWSVGCI
LGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYSNPRFHGLRFP
AVNHPQSLERRYLGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQTQ
RLLDRSPSRSAKRKPYHVESSTLSNRNQAGKSTALQSHHRSNSKDIQNLS
VGLPRADEGLPANESFLNGNLAGASLSPLHTKTYQASSQPGSTSKDLTNN
NIPHLLSPKEAKSKTEFDFNIDPKPSEGPGTKYLKSNSRSQQNRHSFMES
SQSKAGTLQPNEKQSRHSYIDTIPQSSRSPSYRTKAKSHGALSDSKSVSN
LSEARAQIAEPSTSRYFPSSCLDLNSPTSPTPTRHSDTRTLLSPSGRNNR
NEGTLDSRRTTTRHSKTMEELKLPEHMDSSHSHSLSAPHESFSYGLGYTS
PFSSQQRPHRHSMYVTRDKVRAKGLDGSLSIGQGMAARANSLQLLSPQPG
EQLPPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKEN
RHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHS
KRQPAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDSPD
LLTLQKSIHSASTPSSRPKEWRPEKISDLQTQSQPLKSLRKLLHLSSASN
HPASSDPRFQPLTAQQTKNSFSEIRIHPLSQASGGSSNIRQEPAPKGRPA
LQLPDGGCDGRRQRHHSGPQDRRFMLRTTEQQGEYFCCGDPKKPHTPCVP
NRALHRPISSPAPYPVLQVRGTSMCPTLQVRGTDAFSCPTQQSGFSFFVR
HVMREALIHRAQVNQAALLTYHENAALTGK*

Index