Stock Number Hs1238

Human Gene: CDKL3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CDKL3 Cyclin Dependent Kinase Like 3 HGNC:15483 5q31.1 CG7236 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection IOH25876 pGW-HA.attB NM_001113575.1 Reference Closed

Stocks

Docking Site DGRC BDSC FBti
VK33NO84782

Sequences

DNA sequence (1779 bp) Protein sequence (593 aa)
ATGGAGATGTATGAAACCCTTGGAAAAGTGGGAGAGGGAAGTTACGGAAC
AGTCATGAAATGTAAACATAAGAATACTGGGCAGATAGTGGCCATTAAGA
TATTTTATGAGAGACCAGAACAATCTGTCAACAAAATTGCGATGAGAGAA
ATAAAGTTTCTAAAGCAATTTCATCACGAAAACCTGGTCAATCTGATTGA
AGTTTTTAGACAGAAAAAGAAAATTCATTTGGTATTTGAATTTATTGACC
ACACAGTATTAGATGAGTTACAACATTATTGTCATGGACTAGAGAGTAAG
CGACTTAGAAAATACCTCTTCCAGATCCTTCGAGCAATTGACTATCTTCA
CAGTAATAATATCATTCATCGAGATATAAAACCTGAGAATATTTTAGTAT
CCCAGTCAGGAATTACTAAGCTCTGTGATTTTGGTTTTGCACGAACACTA
GCAGCTCCTGGGGACATTTATACGGACTATGTGGCCACACGCTGGTATAG
AGCTCCCGAATTAGTATTAAAAGATACTTCTTATGGAAAACCTGTGGATA
TCTGGGCTTTGGGCTGTATGATCATTGAGATGGCCACTGGAAATCCCTAT
CTTCCTAGTAGTTCTGATTTGGATTTACTCCATAAAATTGTTTTGAAAGT
GGGCAATTTGTCACCTCACTTGCAGAATATCTTTTCCAAGAGCCCCATTT
TTGCTGGGGTAGTTCTTCCTCAAGTTCAACACCCCAAAAATGCAAGAAAA
AAATATCCAAAGCTTAATGGATTGTTGGCAGATATAGTTCATGCTTGTTT
ACAAATTGATCCTGCTGACAGGATATCATCTAGTGATCTTTTGCATCATG
AGTATTTTACTAGAGATGGATTTATTGAAAAATTCATGCCAGAACTGAAA
GCTAAATTACTGCAGGAAGCAAAAGTCAATTCATTAATAAAGCCAAAAGA
GAGTTCTAAAGAAAATGAACTCAGGAAAGATGAAAGAAAAACAGTTTATA
CCAATACACTGCTAAGTAGTTCAGTTTTGGGAAAGGAAATAGAAAAAGAG
AAAAAGCCCAAGGAGATCAAAGTCAGAGTTATTAAAGTCAAAGGAGGAAG
AGGAGATATCTCAGAACCAAAAAAGAAAGAGTATGAAGGTGGACTTGGTC
AACAGGATGCAAATGAAAATGTTCATCCTATGTCTCCAGATACAAAACTT
GTAACCATTGAACCACCAAACCCTATCAATCCCAGCACTAACTGTAATGG
CTTGAAAGAAAATCCACATTGCGGAGGTTCTGTGACAATGCCACCCATCA
ATCTAACTAACAGTAATTTGATGGCTGCAAATCTCAGTTCAAATCTCTTT
CACCCCAGTGTGAGGTTAACTGAAAGAGCAAAAAAGAGACGCACTTCTTC
ACAATCTATTGGACAAGTTATGCCTAATAGCAGGCAAGAGGATCCAGGTC
CTATTCAAAGCCAAATGGAGAAGGGTATATTTAATGAGCGAACAGGTCAC
AGTGACCAAATGGCAAATGAGAACAAAAGGAAGCTGAATTTTTCCAGATC
TGACAGGAAAGAATTCCATTTTCCAGAATTGCCTGTCACAATACAGTCAA
AAGATACAAAAGGAATGGAAGTTAAACAGATAAAAATGCTGAAGAGGGAG
TCAAAGAAAACAGAGTCATCTAAGATACCAACTTTACTTAACGTGGATCA
AAATCAAGAAAAACAAGAGGGTGGAGATGGCCATTGCGAGGGGAAGAATT
TGAAGAGAAACAGGTTTTTTTTCTGGTAG
MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAMRE
IKFLKQFHHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESK
RLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITKLCDFGFARTL
AAPGDIYTDYVATRWYRAPELVLKDTSYGKPVDIWALGCMIIEMATGNPY
LPSSSDLDLLHKIVLKVGNLSPHLQNIFSKSPIFAGVVLPQVQHPKNARK
KYPKLNGLLADIVHACLQIDPADRISSSDLLHHEYFTRDGFIEKFMPELK
AKLLQEAKVNSLIKPKESSKENELRKDERKTVYTNTLLSSSVLGKEIEKE
KKPKEIKVRVIKVKGGRGDISEPKKKEYEGGLGQQDANENVHPMSPDTKL
VTIEPPNPINPSTNCNGLKENPHCGGSVTMPPINLTNSNLMAANLSSNLF
HPSVRLTERAKKRRTSSQSIGQVMPNSRQEDPGPIQSQMEKGIFNERTGH
SDQMANENKRKLNFSRSDRKEFHFPELPVTIQSKDTKGMEVKQIKMLKRE
SKKTESSKIPTLLNVDQNQEKQEGGDGHCEGKNLKRNRFFFW*

Index