Stock Number Hs1237

Human Gene: CDKL2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CDKL2 Cyclin Dependent Kinase Like 2 HGNC:1782 4q21.1 CG7236 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection IOH82113 pGW-HA.attB NM_003948.3 Reference Closed

Stocks

Docking Site DGRC BDSC FBti
VK33NO84781

Sequences

DNA sequence (1482 bp) Protein sequence (494 aa)
ATGGAAAAATATGAAAACCTGGGTTTGGTTGGAGAAGGGAGTTATGGAAT
GGTGATGAAGTGTAGGAATAAAGATACTGGAAGAATTGTGGCCATAAAGA
AGTTCTTAGAAAGTGACGATGACAAAATGGTTAAAAAGATTGCAATGCGA
GAAATCAAGTTACTAAAGCAACTTAGGCATGAAAACTTGGTGAATCTCTT
GGAAGTGTGTAAGAAAAAAAAACGATGGTACCTAGTCTTTGAATTTGTTG
ACCACACAATTCTTGATGACTTGGAGCTCTTTCCAAATGGACTAGACTAC
CAAGTAGTTCAAAAGTATTTGTTTCAGATTATTAATGGAATTGGATTTTG
TCACAGTCACAATATCATACACAGAGATATAAAGCCAGAGAATATATTAG
TCTCCCAGTCTGGCGTTGTCAAGCTATGCGATTTTGGATTTGCGCGAACA
TTGGCAGCTCCTGGGGAGGTTTATACTGATTATGTGGCAACCCGATGGTA
CAGAGCTCCAGAACTATTGGTTGGTGATGTCAAGTATGGCAAGGCTGTTG
ATGTGTGGGCCATTGGTTGTCTGGTAACTGAAATGTTCATGGGGGAACCC
CTATTTCCTGGAGATTCTGATATTGATCAGCTATATCATATTATGATGTG
TTTAGGTAATCTAATTCCAAGGCATCAGGAGCTTTTTAATAAAAATCCTG
TGTTTGCTGGAGTAAGGTTGCCTGAAATCAAGGAAAGAGAACCTCTTGAA
AGACGCTATCCTAAGCTCTCTGAAGTGGTGATAGATTTAGCAAAGAAATG
CTTACATATTGACCCCGACAAAAGACCCTTCTGTGCTGAGCTCCTACACC
ATGATTTCTTTCAAATGGATGGATTTGCTGAGAGGTTTTCCCAAGAACTA
CAGTTAAAAGTACAGAAAGATGCCAGAAATGTTTCTTTATCTAAAAAATC
CCAAAACAGAAAGAAGGAAAAAGAAAAAGATGATTCCTTAGTTGAAGAAA
GAAAAACACTTGTGGTACAGGATACCAATGCTGATCCCAAAATTAAGGAT
TATAAACTATTTAAAATAAAAGGCTCAAAAATTGATGGAGAAAAAGCTGA
AAAAGGCAATAGAGCTTCAAATGCCAGCTGTCTCCATGACAGTAGGACAA
GCCACAACAAAATAGTGCCTTCAACAAGCCTCAAAGACTGCAGCAATGTC
AGCGTGGACCACACAAGGAATCCAAGCGTGGCAATTCCCCCACTTACACA
CAATCTTTCTGCAGTTGCTCCCAGCATTAATTCTGGAATGGGGACTGAGA
CTATACCAATTCAGGGTTACAGAGTGGATGAGAAAACTAAGAAGTGTTCT
ATTCCATTTGTTAAACCGAACAGACATTCCCCATCAGGCATTTATAACAT
TAATGTGACCACATTAGTATCAGGACCTCCCCTGTCAGATGATTCAGGGG
CTGATTTGCCTCAAATGGAACACCAGCACTGA
MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR
EIKLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLELFPNGLDY
QVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFART
LAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDVWAIGCLVTEMFMGEP
LFPGDSDIDQLYHIMMCLGNLIPRHQELFNKNPVFAGVRLPEIKEREPLE
RRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQEL
QLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPKIKD
YKLFKIKGSKIDGEKAEKGNRASNASCLHDSRTSHNKIVPSTSLKDCSNV
SVDHTRNPSVAIPPLTHNLSAVAPSINSGMGTETIPIQGYRVDEKTKKCS
IPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQMEHQH*

Index