Stock Number Hs1236

Human Gene: HOXD12


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HOXD12 homeobox D12 HGNC:5135 2q31.1 Abd-B 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_10889 pGW-HA.attB Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO84780

Sequences

DNA sequence (885 bp) Protein sequence (295 aa)
ATGTGTGAGCGCAGTCTCTACAGAGCGGGCTATGTGGGCTCGCTTCTGAA
TCTGCAGTCGCCAGACTCTTTCTACTTCTCCAACCTGAGGCCGAATGGCG
GCCAGTTGGCCGCGCTTCCCCCTATCTCCTACCCGCGCGGCGCGCTGCCC
TGGGCCGCCACGCCCGCCTCCTGCGCCCCCGCGCAGCCTGCGGGCGCCAC
TGCCTTCGGCGGCTTCTCGCAGCCCTACCTGGCTGGCTCCGGGCCTCTCG
GCCTGCAGCCCCCAACAGCCAAAGACGGACCCGAAGAGCAGGCTAAGTTC
TATGCGCCCGAAGCGGCCGCTGGGCCAGAGGAGCGCGGTCGTACCCGGCC
GTCCTTCGCCCCCGAGTCTAGCCTGGCTCCTGCAGTGGCTGCTCTCAAAG
CGGCCAAGTATGACTACGCTGGTGTGGGTCGTGCCACGCCGGGCTCCACG
ACCCTGCTCCAGGGGGCTCCCTGCGCCCCTGGCTTCAAGGACGACACCAA
GGGCCCGCTCAACTTGAACATGACAGTGCAGGCGGCGGGCGTTGCCTCTT
GCCTGCGACCTTCACTGCCCGACGGTAAACGGTGCCCATGCTCCCCGGGC
CGGTTTGGGCCGGGATGGGAGGTGGGGTTCAAGGGAGAGTGTAAGGGGAG
GTACCCAGCTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTC
TACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCT
ACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATA
CGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAG
GATCCTATCCATATGACGTTCCAGATTACGCTTGA
MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALP
WAATPASCAPAQPAGATAFGGFSQPYLAGSGPLGLQPPTAKDGPEEQAKF
YAPEAAAGPEERGRTRPSFAPESSLAPAVAALKAAKYDYAGVGRATPGST
TLLQGAPCAPGFKDDTKGPLNLNMTVQAAGVASCLRPSLPDGKRCPCSPG
RFGPGWEVGFKGECKGRYPAFLYKVVVPRSSYSLLSIGTSILGAPSGGGA
TAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index