Stock Number Hs1235

Human Gene: HOXD10


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HOXD10 homeobox D10 HGNC:5133 2q31.1 Abd-B 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_00780 pGW-HA.attB Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO84779

Sequences

DNA sequence (1254 bp) Protein sequence (418 aa)
ATGTCCTTTCCCAACAGCTCTCCTGCTGCTAATACTTTTTTAGTAGATTC
CTTGATCAGTGCCTGCAGGAGTGACAGTTTTTATTCCAGCAGCGCCAGCA
TGTACATGCCACCACCTAGCGCAGACATGGGGACCTATGGAATGCAAACC
TGTGGACTGCTCCCGTCTCTGGCCAAAAGAGAAGTGAACCACCAAAATAT
GGGTATGAATGTGCATCCTTATATACCTCAAGTAGACAGTTGGACAGATC
CGAACAGATCTTGTCGAATAGAGCAACCTGTTACACAGCAAGTCCCCACT
TGCTCCTTCACCACCAACATTAAGGAAGAATCCAATTGCTGCATGTATTC
TGATAAGCGCAACAAACTCATTTCGGCCGAGGTCCCTTCGTACCAGAGGC
TGGTCCCTGAGTCTTGTCCCGTTGAGAACCCTGAGGTTCCCGTCCCTGGA
TATTTTAGACTGAGTCAGACCTACGCCACCGGGAAAACCCAAGAGTACAA
TAATAGCCCCGAAGGCAGCTCCACTGTCATGCTCCAGCTCAACCCTCGTG
GCGCGGCCAAGCCGCAGCTCTCCGCTGCCCAGCTGCAGATGGAAAAGAAG
ATGAACGAGCCCGTGAGCGGCCAGGAGCCCACCAAAGTCTCCCAGGTGGA
GAGCCCCGAGGCCAAAGGCGGCCTTCCCGAAGAGAGGAGCTGCCTGGCTG
AGGTCTCCGTGTCCAGTCCCGAAGTGCAGGAGAAGGAAAGCAAAGAGGAA
ATCAAGTCTGATACACCAACCAGCAATTGGCTCACTGCAAAGAGTGGCAG
AAAGAAGAGGTGCCCTTACACTAAGCACCAAACGCTGGAATTAGAAAAAG
AGTTCTTGTTCAATATGTACCTCACCCGCGAGCGCCGCCTAGAGATCAGT
AAGAGCGTTAACCTCACCGACAGGCAGGTCAAGATTTGGTTTCAAAACCG
CCGAATGAAACTCAAGAAGATGAGCCGAGAGAACCGGATCCGAGAACTGA
CCGCCAACCTCACGTTTTCTTACCCAGCTTTCTTGTACAAAGTGGTGGTA
CCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGC
TCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTG
CGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTAT
GACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGC
TTGA
MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQT
CGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPT
CSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPG
YFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKK
MNEPVSGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEE
IKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEIS
KSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFSYPAFLYKVVV
PRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPY
DVPDYAGSYPYDVPDYA*

Index