Stock Number Hs1234

Human Gene: HOXC10


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HOXC10 homeobox C10 HGNC:5122 12q13.13 Abd-B 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_00778 pGW-HA.attB Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO84778

Sequences

DNA sequence (1260 bp) Protein sequence (420 aa)
ATGACATGCCCTCGCAATGTAACTCCGAACTCGTACGCGGAGCCCTTGGC
TGCGCCCGGCGGAGGAGAGCGCTATAGCCGGAGCGCAGGCATGTATATGC
AGTCTGGGAGTGACTTCAATTGCGGGGTGATGAGGGGCTGCGGGCTCGCG
CCCTCGCTCTCCAAGAGGGACGAGGGCAGCAGCCCCAGCCTCGCCCTCAA
CACCTATCCGTCCTACCTCTCGCAGCTGGACTCCTGGGGCGACCCCAAAG
CCGCCTATCGCCTGGAACAACCTGTTGGCAGGCCGCTGTCCTCCTGCTCC
TACCCACCTAGTGTCAAGGAGGAGAATGTCTGCTGCATGTACAGCGCAGA
GAAGCGGGCGAAAAGTGGCCCCGAGGCAGCTCTCTACTCCCACCCCTTGC
CGGAGTCCTGCCTTGGGGAGCACGAGGTACCCGTGCCCAGCTACTACCGC
GCCAGCCCGAGCTACTCCGCGCTGGACAAGACGCCCCACTGTTCTGGGGC
CAACGACTTCGAAGCCCCTTTCGAGCAGCGGGCCAGTCTCAACCCGCGCG
CCGAACATCTGGAATCGCCTCAGCTGGGGGGCAAAGTGAGTTTCCCTGAG
ACCCCCAAGTCCGACAGCCAGACCCCCAGCCCCAATGAAATCAAGACGGA
GCAGAGCCTGGCGGGCCCTAAAGGGAGCCCCTCGGAGAGCGAAAAGGAGA
GGGCCAAAGCTGCCGACTCCAGCCCAGACACCTCGGATAACGAAGCGAAA
GAGGAGATAAAGGCAGAAAACACCACAGGAAATTGGCTGACAGCAAAGAG
CGGAAGGAAGAAGAGGTGCCCCTATACTAAACACCAGACGCTGGAATTGG
AGAAAGAATTTCTGTTCAATATGTATTTGACGCGAGAGCGCCGCCTGGAG
ATTAGCAAGACCATTAACCTTACAGACAGACAAGTCAAAATCTGGTTTCA
AAATCGCAGAATGAAACTCAAGAAAATGAACCGAGAGAATCGGATCCGGG
AACTGACCTCCAATTTTAATTTCACCTACCCAGCTTTCTTGTACAAAGTG
GTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCT
TGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTG
GACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTAT
CCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGA
TTACGCTTGA
MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLA
PSLSKRDEGSSPSLALNTYPSYLSQLDSWGDPKAAYRLEQPVGRPLSSCS
YPPSVKEENVCCMYSAEKRAKSGPEAALYSHPLPESCLGEHEVPVPSYYR
ASPSYSALDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPE
TPKSDSQTPSPNEIKTEQSLAGPKGSPSESEKERAKAADSSPDTSDNEAK
EEIKAENTTGNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLE
ISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFTYPAFLYKV
VVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGY
PYDVPDYAGSYPYDVPDYA*

Index