Stock Number Hs1232

Human Gene: HOXB13


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HOXB13 homeobox B13 HGNC:5112 17q21.32 Abd-B 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection IOH7543 pGW-HA.attB Reference Closed

Stocks

Docking Site DGRC BDSC FBti
VK37NO84777

Sequences

DNA sequence (855 bp) Protein sequence (285 aa)
ATGGAGCCCGGCAATTATGCCACCTTGGATGGAGCCAAGGATATCGAAGG
CTTGCTGGGAGCGGGAGGGGGGCGGAATCTGGTCGCCCACTCCCCTCTGA
CCAGCCACCCAGCGGCGCCTACGCTGATGCCTGCTGTCAACTATGCCCCC
TTGGATCTGCCAGGCTCGGCGGAGCCGCCAAAGCAATGCCACCCATGCCC
TGGGGTGCCCCAGGGGACGTCCCCAGCTCCCGTGCCTTATGGTTACTTTG
GAGGCGGGTACTACTCCTGCCGAGTGTCCCGGAGCTCGCTGAAACCCTGT
GCCCAGGCAGCCACCCTGGCCGCGTACCCCGCGGAGACTCCCACGGCCGG
GGAAGAGTACCCCAGCCGCCCCACTGAGTTTGCCTTCTATCCGGGATATC
CGGGAACCTACCAGCCTATGGCCAGTTACCTGGACGTGTCTGTGGTGCAG
ACTCTGGGTGCTCCTGGAGAACCGCGACATGACTCCCTGTTGCCTGTGGA
CAGTTACCAGTCTTGGGCTCTCGCTGGTGGCTGGAACAGCCAGATGTGTT
GCCAGGGAGAACAGAACCCACCAGGTCCCTTTTGGAAGGCAGCATTTGCA
GACTCCAGCGGGCAGCACCCTCCTGACGCCTGCGCCTTTCGTCGCGGCCG
CAAGAAACGCATTCCGTACAGCAAGGGGCAGTTGCGGGAGCTGGAGCGGG
AGTATGCGGCTAACAAGTTCATCACCAAGGACAAGAGGCGCAAGATCTCG
GCAGCCACCAGCCTCTCGGAGCGCCAGATTACCATCTGGTTTCAGAACCG
CCGGGTCAAAGAGAAGAAGGTTCTCGCCAAGGTGAAGAACAGCGCTACCC
CTTAA
MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAP
LDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPC
AQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPMASYLDVSVVQ
TLGAPGEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFA
DSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKFITKDKRRKIS
AATSLSERQITIWFQNRRVKEKKVLAKVKNSATP*

Index