Stock Number Hs1231

Human Gene: HOXB9


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HOXB9 homeobox B9 HGNC:5120 17q21.32 Abd-B 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection IOH57178 pGW-HA.attB Reference Closed

Stocks

Docking Site DGRC BDSC FBti
VK37NO84776

Sequences

DNA sequence (753 bp) Protein sequence (251 aa)
ATGTCCATTTCTGGGACGCTTAGCAGCTATTATGTCGACTCGATCATAAG
TCACGAGAGTGAGGACGCGCCTCCAGCCAAGTTTCCTTCTGGCCAGTACG
CGAGCTCGCGGCAGCCGGGCCACGCGGAGCACCTGGAGTTCCCCTCGTGC
AGCTTCCAGCCCAAAGCGCCGGTGTTCGGCGCCTCCTGGGCGCCGCTGAG
CCCGCACGCGTCCGGGAGCCTGCCGTCCGTCTACCACCCTTACATCCAGC
CCCAGGGCGTCCCGCCGGCCGAGAGCAGGTACCTCCGCACCTGGCTGGAG
CCGGCGCCGCGCGGCGAAGCGGCCCCGGGGCAGGGCCAGGCGGCGGTGAA
GGCGGAGCCGCTGCTGGGCGCGCCTGGGGAGCTGCTCAAACAGGGCACGC
CCGAGTACAGTTTGGAAACTTCGGCGGGCAGGGAGGCCGTGCTGTCTAAT
CAAAGACCCGGCTACGGGGACAATAAAATTTGCGAAGGAAGCGAGGACAA
AGAGAGGCCGGATCAAACCAACCCCTCCGCCAACTGGCTGCACGCTCGCT
CTTCCCGGAAAAAGCGCTGTCCCTACACCAAATACCAGACGCTGGAGCTA
GAGAAGGAGTTTCTGTTCAATATGTACCTCACCAGGGACCGTAGGCACGA
AGTGGCCAGACTCCTCAATCTGAGTGAGAGACAAGTCAAAATCTGGTTTC
AGAACCGGCGGATGAAAATGAAGAAAATGAATAAGGAGCAGGGCAAAGAG
TAA
MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSC
SFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLE
PAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSN
QRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLEL
EKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE
*

Index