Stock Number Hs1230

Human Gene: HOXA11


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HOXA11 homeobox A11 HGNC:5101 7p15.2 Abd-B 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection IOH56448 pGW-HA.attB Reference Closed

Stocks

Docking Site DGRC BDSC FBti
VK37NO84775

Sequences

DNA sequence (942 bp) Protein sequence (314 aa)
ATGGATTTTGATGAGCGTGGTCCCTGCTCCTCTAACATGTATTTGCCAAG
TTGTACTTACTACGTCTCGGGTCCAGATTTCTCCAGCCTCCCTTCTTTTC
TGCCCCAGACCCCGTCTTCGCGCCCAATGACATACTCCTACTCCTCCAAC
CTGCCCCAGGTCCAACCCGTGCGCGAAGTGACCTTCAGAGAGTACGCCAT
TGAGCCCGCCACTAAATGGCACCCCCGCGGCAATCTGGCCCACTGCTACT
CCGCGGAGGAGCTCGTGCACAGAGACTGCCTGCAGGCGCCCAGCGCGGCC
GGCGTGCCTGGCGACGTGCTGGCCAAGAGCTCGGCCAACGTCTACCACCA
CCCCACCCCCGCAGTCTCGTCCAATTTCTATAGCACCGTGGGCAGGAACG
GCGTCCTGCCACAGGCTTTCGACCAGTTTTTCGAGACAGCCTACGGCACC
CCGGAAAACCTCGCCTCCTCCGACTACCCCGGGGACAAGAGCGCCGAGAA
GGGGCCCCCGGCGGCCACGGCGACCTCCGCGGCGGCGGCGGCGGCTGCAA
CGGGCGCGCCGGCAACTTCAAGTTCGGACAGCGGCGGCGGCGGCGGCTGC
CGGGAGACGGCGGCGGCAGCAGAGGAGAAAGAGCGGCGGCGGCGCCCCGA
GAGCAGCAGCAGCCCCGAGTCGTCTTCCGGCCACACTGAGGACAAGGCCG
GCGGCTCCAGTGGCCAACGCACCCGCAAAAAGCGCTGCCCCTATACCAAG
TACCAGATCCGAGAGCTGGAACGGGAGTTCTTCTTCAGCGTCTACATTAA
CAAAGAGAAGCGCCTGCAACTGTCCCGCATGCTCAACCTCACTGATCGTC
AAGTCAAAATCTGGTTTCAGAACAGGAGAATGAAGGAAAAAAAAATTAAC
AGAGACCGTTTACAGTACTACTCAGCAAATCCACTCCTCTAA
MDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSN
LPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAA
GVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQFFETAYGT
PENLASSDYPGDKSAEKGPPAATATSAAAAAAATGAPATSSSDSGGGGGC
RETAAAAEEKERRRRPESSSSPESSSGHTEDKAGGSSGQRTRKKRCPYTK
YQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKIN
RDRLQYYSANPLL*

Index