Stock Number Hs1229

Human Gene: HOXA10


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HOXA10 homeobox A10 HGNC:5100 7p15.2 Abd-B 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_00774 pGW-HA.attB Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO84774

Sequences

DNA sequence (516 bp) Protein sequence (172 aa)
ATGTGTCAAGGCAATTCCAAAGGTGAAAACGCAGCCAACTGGCTCACGGC
AAAGAGTGGTCGGAAGAAGCGCTGCCCCTACACGAAGCACCAGACACTGG
AGCTGGAGAAGGAGTTTCTGTTCAATATGTACCTTACTCGAGAGCGGCGC
CTAGAGATTAGCCGCAGCGTCCACCTCACGGACAGACAAGTGAAAATCTG
GTTTCAGAACCGCAGGATGAAACTGAAGAAAATGAATCGAGAAAACCGGA
TCCGGGAGCTCACAGCCAACTTTAATTTTTCCTACCCAGCTTTCTTGTAC
AAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTC
CATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAG
CCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCG
GGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGT
TCCAGATTACGCTTGA
MCQGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERR
LEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFSYPAFLY
KVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYA
GYPYDVPDYAGSYPYDVPDYA*

Index