Stock Number Hs1211

Human Gene: SHKBP1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SHKBP1 SH3KBP1 Binding Protein 1 HGNC:19214 19q13.2 CG9467 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_09350 BC022855.1 pUASgHA.attB BC022855.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO84773

Sequences

DNA sequence (2310 bp) Protein sequence (770 aa)
ATGGCAGCAGCGGCTACTGCAGCCGAGGGGGTCCCCAGTCGGGGGCCTCC
CGGGGAAGTCATCCATCTGAATGTGGGAGGCAAGAGATTCAGTACCTCTC
GCCAGACTCTCACCTGGATCCCAGACTCCTTCTTCTCCAGTCTTCTGAGC
GGACGCATCTCGACGCTGAAAGATGAGACCGGAGCAATCTTCATCGACAG
GGACCCTACAGTCTTCGCCCCCATCCTCAACTTCCTGCGCACCAAAGAGT
TGGATCCCAGGGGTGTCCACGGTTCCAGCCTCCTCCATGAAGCCCAGTTC
TATGGGCTCACTCCTCTGGTTCGTCGCCTGCAGCTTCGAGAGGAGTTGGA
TCGATCTTCTTGTGGAAACGTCCTCTTCAATGGTTACCTGCCGCCACCAG
TGTTCCCAGTGAAGCGGCGGAACCGGCACAGCCTAGTGGGGCCTCAGCAG
CTAGGAGGACGGCCAGCCCCTGTCCGACGGAGCAACACGATGCCCCCCAA
CCTTGGCAATGCAGGGCTGCTGGGCCGAATGCTGGATGAGAAAACCCCTC
CCTCACCCTCAGGACAACCTGAGGAGCCGGGGATGGTGCGCCTGGTGTGT
GGACACCATAATTGGATCGCTGTGGCCTATACCCAGTTTCTAGTCTGCTA
CAGGTTGAAGGAAGCCTCTGGCTGGCAGCTGGTGTTTTCCAGCCCCCGCC
TGGACTGGCCCATCGAACGACTGGCGCTCACAGCCCGGGTGCATGGTGGG
GCTTTGGGTGAACATGACAAGATGGTGGCAGCAGCCACCGGCAGCGAGAT
CCTGCTATGGGCTCTGCAGGCGGAAGGCGGTGGCTCCGAGATAGGGGTCT
TTCATCTGGGGGTGCCTGTGGAGGCCTTGTTCTTCGTCGGGAACCAGCTC
ATTGCTACAAGCCACACAGGGCGCATCGGGGTGTGGAATGCCGTCACCAA
GCACTGGCAGGTCCAGGAGGTGCAGCCCATCACCAGTTATGACGCGGCAG
GCTCCTTCCTCCTCCTGGGCTGCAACAACGGCTCCATTTACTACGTGGAT
GTGCAGAAGTTCCCCTTGCGCATGAAAGACAACGACCTCCTTGTCAGCGA
GCTCTATCGGGACCCAGCGGAGGATGGGGTCACCGCCCTCAGTGTCTACC
TCACCCCCAAGACCAGTGACAGTGGGAACTGGATCGAGATCGCCTATGGC
ACCAGCTCAGGGGGCGTGCGGGTCATCGTGCAGCACCCGGAGACTGTGGG
CTCGGGGCCTCAGCTCTTCCAGACCTTCACTGTGCACCGCAGCCCTGTCA
CCAAGATCATGCTGTCGGAGAAGCACCTCATCTCAGTCTGTGCCGACAAC
AACCACGTGCGGACATGGTCTGTGACTCGCTTCCGCGGCATGATTTCCAC
CCAGCCCGGCTCCACCCCACTCGCTTCCTTTAAGATCCTGGCTCTGGAGT
CGGCAGATGGGCATGGCGGCTGCAGTGCTGGCAATGACATTGGCCCCTAC
GGTGAGCGGGACGACCAGCTAGTGTTCATCCAGAAGGTGGTGCCCAGTGC
CAGCCAGCTCTTCGTGCGTCTCTCATCTACTGGGCAGCGGGTGTGCTCCG
TGCGCTCCGTGGACGGCTCACCCACGACGGCCTTCACAGTGCTGGAGTGC
GAGGGCTCCCGGCGGCTCGGCTCTCGGCCCCGGCGCTACCTGCTCACTGG
CCAGGCCAACGGCAGCTTGGCCATGTGGGACCTAACCACCGCCATGGACG
GCCTCGGCCAGGCCCCTGCAGGTGGCCTGACGGAGCAAGAGCTGATGGAA
CAGCTGGAACACTGTGAGCTGGCCCCGCCGGCTCCTTCAGCTCCCTCATG
GGGCTGTCTCCCCAGCCCCTCACCCCGCATCTCCCTCACCAGCCTCCACT
CAGCCTCCAGCAACACCTCCTTGTCTGGCCACCGTGGGAGCCCAAGCCCC
CCGCAGGCTGAGGCCCGGCGCCGTGGTGGGGGCAGCTTTGTGGAACGCTG
CCAGGAACTGGTGCGGAGTGGGCCAGACCTCCGACGGCCACCCACACCAG
CCCCGTGGCCCTCCAGCGGTCTCGGCACTCCCCTCACACCTCCCAAGATG
AAGCTCAATGAAACTTCCTTTTACCCAGCTTTCTTGTACAAAGTGGTGAG
CTCCGCCACCATGGATCTCCACCGCGGTGGAGGCCGCATCTTTTACCCAT
ACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCA
GGATCCTATCCATATGACGTTCCAGATTACGCTGCTCATGGCGGACACCG
GTCCACGTGA
MAAAATAAEGVPSRGPPGEVIHLNVGGKRFSTSRQTLTWIPDSFFSSLLS
GRISTLKDETGAIFIDRDPTVFAPILNFLRTKELDPRGVHGSSLLHEAQF
YGLTPLVRRLQLREELDRSSCGNVLFNGYLPPPVFPVKRRNRHSLVGPQQ
LGGRPAPVRRSNTMPPNLGNAGLLGRMLDEKTPPSPSGQPEEPGMVRLVC
GHHNWIAVAYTQFLVCYRLKEASGWQLVFSSPRLDWPIERLALTARVHGG
ALGEHDKMVAAATGSEILLWALQAEGGGSEIGVFHLGVPVEALFFVGNQL
IATSHTGRIGVWNAVTKHWQVQEVQPITSYDAAGSFLLLGCNNGSIYYVD
VQKFPLRMKDNDLLVSELYRDPAEDGVTALSVYLTPKTSDSGNWIEIAYG
TSSGGVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLISVCADN
NHVRTWSVTRFRGMISTQPGSTPLASFKILALESADGHGGCSAGNDIGPY
GERDDQLVFIQKVVPSASQLFVRLSSTGQRVCSVRSVDGSPTTAFTVLEC
EGSRRLGSRPRRYLLTGQANGSLAMWDLTTAMDGLGQAPAGGLTEQELME
QLEHCELAPPAPSAPSWGCLPSPSPRISLTSLHSASSNTSLSGHRGSPSP
PQAEARRRGGGSFVERCQELVRSGPDLRRPPTPAPWPSSGLGTPLTPPKM
KLNETSFYPAFLYKVVSSATMDLHRGGGRIFYPYDVPDYAGYPYDVPDYA
GSYPYDVPDYAAHGGHRST*

Index