Stock Number Hs1210

Human Gene: KCTD3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
KCTD3 Potassium Channel Tetramerization Domain Containing 3 HGNC:21305 1q41 CG9467 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_08229 BC117188.1 pUASgHA.attB BC117188.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO84772

Sequences

DNA sequence (2634 bp) Protein sequence (878 aa)
ATGGCGGGAGGGCACTGCGGCAGCTTCCCCGCGGCGGCGGCCGGCAGCGG
CGAGATCGTCCAACTGAACGTAGGGGGGACCAGATTTAGTACCTCAAGAC
AAACTCTTATGTGGATTCCAGATTCTTTTTTTTCCAGTTTGCTGAGTGGG
AGAATTTCAACACTTCGAGATGAAACTGGTGCTATATTTATTGATAGAGA
TCCAGCAGCATTTGCACCCATTTTAAATTTTCTTCGGACAAAAGAACTAG
ACTTAAGGGGAGTGAGTATTAATGTTCTCAGGCATGAAGCAGAATTTTAC
GGGATCACTCCATTAGTAAGAAGGCTTCTCTTATGTGAAGAATTGGAGCG
TTCCTCTTGTGGCAGTGTCCTTTTTCATGGTTACTTGCCCCCACCAGGTA
TTCCTAGTCGTAAAATAAACAACACAGTCAGATCTGCTGATTCTAGGAAT
GGTCTAAATTCTACAGAAGGTGAAGCCCGGGGAAATGGTACACAGCCTGT
TCTCTCTGGAACGGGAGAAGAAACTGTTAGGCTAGGATTTCCTGTGGATC
CACGAAAGGTGCTAATAGTAGCTGGCCATCACAACTGGATTGTAGCTGCA
TATGCCCATTTTGCTGTGTGTTACAGAATCAAAGAATCTTCAGGATGGCA
GCAAGTGTTTACGAGCCCATATTTGGATTGGACTATCGAACGAGTAGCTT
TAAATGCAAAGGTGGTTGGAGGGCCACATGGAGACAAAGACAAAATGGTT
GCTGTTGCCTCAGAGAGTAGCATCATCTTGTGGAGTGTTCAGGATGGGGG
AAGTGGAAGTGAAATTGGAGTGTTCAGCCTGGGTGTTCCTGTAGATGCTC
TCTTCTTTATTGGTAACCAGTTGGTGGCCACGAGTCATACAGGGAAAGTG
GGAGTGTGGAATGCTGTCACTCAGCACTGGCAGGTTCAAGATGTTGTTCC
TATAACTAGTTATGACACTGCTGGATCATTCCTTCTGCTTGGATGTAACA
ATGGATCAATATATTACATAGATATGCAGAAGTTCCCCTTGCGAATGAAA
GATAATGATCTTCTTGTAACTGAACTGTATCATGATCCTTCAAATGATGC
TATTACTGCTCTGAGTGTTTACCTCACACCCAAAACAAGTGTCAGTGGTA
ACTGGATCGAGATCGCCTATGGTACGAGCTCTGGAGCAGTACGAGTGATT
GTACAACACCCAGAGACAGTTGGGTCAGGTCCTCAGCTTTTTCAGACTTT
CACAGTTCACCGAAGTCCCGTAACAAAAATCATGCTATCAGAGAAGCATC
TTGTATCAGTCTGTGCAGATAATAATCATGTCCGGACGTGGACAGTAACA
CGATTCAGAGGAATGATCTCTACTCAGCCAGGTTCTACTCCTTTAGCGTC
ATTCAAGATACTATCCCTGGAGGAGACAGAAAGTCATGGTAGCTATTCCT
CTGGAAATGACATAGGACCTTTTGGAGAGCGAGACGATCAACAGGTGTTT
ATCCAGAAAGTTGTTCCCATCACCAACAAACTATTTGTAAGACTCTCATC
GACTGGAAAAAGAATATGTGAGATCCAGGCTGTTGACTGTACTACAATAT
CCTCATTTACAGTGAGGGAATGTGAGGGATCCAGTAGGATGGGCTCAAGA
CCAAGGCGCTACTTGTTCACAGGCCATACAAATGGCAGTATTCAAATGTG
GGATCTGACCACTGCTATGGATATGGTTAACAAAAGTGAAGATAAGGATG
TAGGTGGTCCAACCGAAGAAGAGCTACTCAAATTACTCGATCAATGTGAT
TTGAGCACATCTCGCTGTGCTACTCCTAACATCAGTCCAGCAACTTCCGT
AGTTCAGCATAGCCACTTACGAGAATCAAATTCTAGCCTTCAGCTTCAGC
ACCATGATACCACCCATGAAGCAGCTACTTACGGTTCCATGAGGCCTTAC
AGAGAAAGTCCTTTATTAGCAAGGGCAAGAAGGACTGAGAGCTTTCACAG
TTATAGGGACTTCCAGACTATTAATTTGAACAGAAATGTAGAAAGAGCTG
TCCCTGAAAATGGTAACTTGGGTCCAATACAAGCTGAAGTGAAAGGGGCA
ACAGGGGAATGTAATATATCTGAGAGAAAGTCTCCTGGAGTAGAAATAAA
AAGTTTGAGAGAATTGGATAGTGGATTGGAAGTGCATAAAATAGCTGAAG
GTTTTTCAGAATCCAAGAAAAGGTCATCAGAAGATGAAAATGAAAATAAA
ATAGAGTTTAGGAAGAAAGGAGGATTTGAAGGGGGAGGATTCCTTGGAAG
AAAGAAAGTTCCCTATCTGGCATCATCACCAAGTACTTCCGATGGAGGAA
CTGACTCACCTGGTACTGCGTCCCCATCTCCTACAAAGACTACTCCATCT
CCTCGGCATAAAAAAAGTGATTCTTCAGGTCAGGAGTACAGCTTGTACCC
AGCTTTCTTGTACAAAGTGGTGAGCTCCGCCACCATGGATCTCCACCGCG
GTGGAGGCCGCATCTTTTACCCATACGATGTTCCTGACTATGCGGGCTAT
CCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGA
TTACGCTGCTCATGGCGGACACCGGTCCACGTGA
MAGGHCGSFPAAAAGSGEIVQLNVGGTRFSTSRQTLMWIPDSFFSSLLSG
RISTLRDETGAIFIDRDPAAFAPILNFLRTKELDLRGVSINVLRHEAEFY
GITPLVRRLLLCEELERSSCGSVLFHGYLPPPGIPSRKINNTVRSADSRN
GLNSTEGEARGNGTQPVLSGTGEETVRLGFPVDPRKVLIVAGHHNWIVAA
YAHFAVCYRIKESSGWQQVFTSPYLDWTIERVALNAKVVGGPHGDKDKMV
AVASESSIILWSVQDGGSGSEIGVFSLGVPVDALFFIGNQLVATSHTGKV
GVWNAVTQHWQVQDVVPITSYDTAGSFLLLGCNNGSIYYIDMQKFPLRMK
DNDLLVTELYHDPSNDAITALSVYLTPKTSVSGNWIEIAYGTSSGAVRVI
VQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVT
RFRGMISTQPGSTPLASFKILSLEETESHGSYSSGNDIGPFGERDDQQVF
IQKVVPITNKLFVRLSSTGKRICEIQAVDCTTISSFTVRECEGSSRMGSR
PRRYLFTGHTNGSIQMWDLTTAMDMVNKSEDKDVGGPTEEELLKLLDQCD
LSTSRCATPNISPATSVVQHSHLRESNSSLQLQHHDTTHEAATYGSMRPY
RESPLLARARRTESFHSYRDFQTINLNRNVERAVPENGNLGPIQAEVKGA
TGECNISERKSPGVEIKSLRELDSGLEVHKIAEGFSESKKRSSEDENENK
IEFRKKGGFEGGGFLGRKKVPYLASSPSTSDGGTDSPGTASPSPTKTTPS
PRHKKSDSSGQEYSLYPAFLYKVVSSATMDLHRGGGRIFYPYDVPDYAGY
PYDVPDYAGSYPYDVPDYAAHGGHRST*

Index