Stock Number Hs1209

Human Gene: TECPR2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
TECPR2 Tectonin Beta-Propeller Repeat Containing 2 HGNC:19957 14q32.31 CG11141 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_07505 BC142667.1 pUASgHA.attB BC142667.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33NO84771

Sequences

DNA sequence (3990 bp) Protein sequence (1330 aa)
ATGGCATCGATATCAGAGCCTGTTACATTCAGAGAGTTCTGCCCGTTGTA
CTATCTCCTCAATGCCATTCCGACAAAGATCCAGAAGGGTTTCCGCTCTA
TCGTGGTCTATCTCACGGCCCTCGACACCAACGGGGACTACATCGCGGTG
GGCAGCAGCATCGGCATGCTCTATCTGCACTGCCGGCACCTCAACCAGAT
GAGGAAGTACAACTTTGAGGGGAAGACGGAATCTATCACTGTGGTGAAGC
TGCTGAGCTGCTTTGATGACCTGGTGGCAGCAGGCACAGCCTCTGGCAGG
GTTGCAGTTTTTCAACTTGTATCTTCATTGCCAGGGAGAAATAAACAGCT
TCGGAGATTTGATGTCACTGGTATTCACAAAAATAGCATTACAGCTCTGG
CTTGGAGCCCCAATGGAATGAAATTGTTCTCTGGAGATGACAAAGGCAAA
ATTGTTTATTCTTCTCTGGATCTAGACCAGGGGCTCTGTAACTCCCAGCT
GGTGTTGGAGGAGCCATCTTCCATTGTGCAGCTGGATTATAGCCAGAAAG
TGCTGCTGGTCTCTACTCTGCAAAGAAGTCTGCTCTTTTACACTGAAGAA
AAGTCTGTAAGGCAAATTGGAACACAACCAAGGAAAAGTACTGGGAAATT
TGGTGCTTGTTTTATACCAGGACTCTGTAAGCAAAGTGATCTAACCTTGT
ATGCGTCACGGCCCGGGCTCCGGCTATGGAAGGCTGATGTCCACGGGACT
GTTCAAGCCACGTTTATCTTAAAAGATGCTTTTGCCGGGGGAGTCAAGCC
TTTTGAACTGCACCCGCGTCTGGAATCCCCCAACAGTGGAAGTTGCAGCT
TACCTGAGAGGCACCTGGGGCTTGTTTCATGTTTCTTTCAAGAAGGCTGG
GTGCTGAGTTGGAATGAATATAGTATCTATCTCCTAGACACAGTCAACCA
GGCCACAATTGCTGGTTTGGAAGGATCCGGTGATATTGTGTCTGTTTCGT
GCACAGAAAATGAAATATTTTTCTTGAAAGGAGATAGGAACATTATAAGA
ATTTCAAGCAGGCCTGAAGGATTAACATCAACAGTGAGAGATGGTCTGGA
GATGTCTGGATGCTCAGAGCGTGTCCACGTGCAGCAAGCGGAGAAGCTGC
CAGGGGCCACAGTTTCTGAGACGAGGCTCAGAGGCTCTTCCATGGCCAGC
TCCGTGGCCAGCGAGCCAAGGAGCAGGAGCAGCTCGCTCAACTCCACCGA
CAGCGGCTCCGGGCTCCTGCCCCCTGGGCTCCAGGCCACCCCTGAGCTGG
GCAAGGGCAGCCAGCCCCTGTCACAGAGATTCAACGCCATCAGCTCAGAG
GACTTTGACCAGGAGCTTGTCGTGAAGCCTATCAAAGTGAAAAGGAAGAA
GAAGAAGAAGAAGACAGAAGGTGGAAGCAGGAGCACCTGTCACAGCTCCC
TGGAATCGACACCCTGCTCCGAATTTCCTGGGGACAGTCCCCAGTCCTTG
AACACAGACTTGCTGTCGATGACCTCAAGTGTCCTGGGCAGTAGCGTGGA
TCAGTTAAGTGCAGAGTCTCCAGACCAGGAAAGCAGCTTCAATGGTGAAG
TGAACGGTGTCCCACAGGAAAATACTGACCCCGAAACGTTTAATGTCCTG
GAGGTGTCAGGATCAATGCCTGATTCTCTGGCTGAGGAAGATGACATTAG
AACTGAAATGCCACACTGTCACCATGCACATGGGCGGGAGCTGCTCAATG
GAGCGAGGGAAGATGTGGGAGGCAGTGATGTCACGGGACTCGGAGATGAG
CCGTGTCCTGCAGATGATGGACCAAATAGCACACAGTTACCCTTCCAAGA
ACAGGACAGCTCTCCTGGGGCGCATGATGGGGAAGACATCCAACCCATTG
GCCCCCAAAGCACTTTTTGTGAAGTCCCCCTCCTGAACTCACTCACTGTG
CCTTCCAGCCTCAGCTGGGCCCCAAGTGCTGAACAGTGGCTGCCTGGGAC
CAGAGCTGATGAAGGCAGCCCCGTGGAGCCCAGCCAAGAGCAGGACATCC
TAACCAGCATGGAGGCCTCTGGCCACCTCAGCACAAATCTCTGGCATGCT
GTCACTGATGATGACACAGGTCAGAAAGAAATACCCATTTCTGAACGTGT
CTTGGGGAGTGTGGGAGGACAGCTGACTCCGGTCTCTGCCTTGGCAGCCA
GCACTCACAAGCCCTGGCTTGAGCAGCCTCCACGGGATCAGACATTGACG
TCCAGCGATGAGGAGGACATCTATGCCCACGGGCTTCCTTCTTCATCCTC
AGAGACGAGTGTGACAGAGCTCGGACCTAGTTGCTCCCAGCAGGACCTGA
GCCGGCTGGGTGCAGAGGACGCCGGGCTGCTCAAGCCAGATCAGTTTGCA
GAAAGCTGGATGGGCTACTCGGGTCCCGGCTATGGCATCCTCAGCTTGGT
GGTCTCCGAGAAGTATATCTGGTGCCTGGACTACAAAGGCGGCCTGTTCT
GCAGCGCGTTGCCGGGCGCCGGGCTGCGCTGGCAGAAGTTTGAAGATGCT
GTCCAGCAGGTGGCAGTCTCGCCCTCAGGAGCCCTTCTCTGGAAGATTGA
ACAGAAATCTAACCGGGCTTTTGCTTGTGGGAAAGTCACCATCAAGGGGA
AGCGGCACTGGTACGAAGCCCTGCCCCAGGCAGTGTTTGTGGCCCTGAGC
GATGACACGGCCTGGATCATCAGGACCAGTGGGGACCTATACTTGCAGAC
AGGTCTGAGCGTGGATCGCCCTTGTGCCAGAGCCGTAAAGGTGGACTGTC
CCTACCCGCTGTCCCAGATCACAGCCCGGAACAATGTGGTGTGGGCGCTG
ACAGAGCAGAGGGCCCTCCTGTACCGGGAGGGCGTGAGCAGCTTCTGTCC
GGAAGGCGAGCAGTGGAAGTGTGACATTGTCAGCGAAAGGCAAGCTTTAG
AACCCGTCTGCATAACGCTCGGGGATCAGCAGACTCTCTGGGCCCTGGAC
ATCCATGGGAACCTGTGGTTCAGAACTGGCATTATTTCCAAGAAGCCCCA
AGGAGATGACGACCATTGGTGGCAAGTGAGCATCACGGACTATGTGGTGT
TTGACCAGTGCAGCTTATTTCAGACGATAATCCATGCCACTCACTCGGTG
GCCACAGCAGCCCAAGCCCCCGTAGAAAAGGTGGCAGATAAGCTGCGCAT
GGCGTTTTGGTCCCAGCAGCTTCAGTGCCAGCCAAGCCTTCTCGGGGTCA
ATAACAGCGGTGTCTGGATCTCCTCGGGCAAGAATGAATTCCACGTCGCT
AAGGGAAGTCTCATAGGCACCTACTGGAATCATGTGGTTCCCCGTGGGAC
AGCTTCTGCTACAAAATGGGCCTTTGTGTTGGCTTCTGCAGCTCCCACGA
AGGAAGGAAGCTTCCTGTGGCTGTGCCAGAGCAGCAAGGACCTGTGCAGC
GTCAGCGCCCAGAGCGCACAGTCGCGGCCCTCCACGGTGCAGCTGCCTCC
CGAAGCCGAGATGCGCGCCTATGCCGCCTGCCAGGATGCGCTGTGGGCGC
TGGACAGCCTCGGCCAGGTGTTCATCAGGACGCTCTCCAAGAGCTGCCCC
ACGGGCATGCACTGGACCAGGCTGGACCTCTCCCAGCTAGGAGCTGTAAA
ATTGACAAGCTTGGCATGTGGAAATCAGCACATCTGGGCCTGTGATTCCA
GGGGTGGAGTTTACTTCCGTGTAGGGACTCAGCCTCTCAATCCCAGTCTC
ATGCTTCCAGCCTGGATAATGATTGAGCCACCTGTCCAGGTAAGCAGAAG
TTACCCAGCTTTCTTGTACAAAGTGGTGAGCTCCGCCACCATGGATCTCC
ACCGCGGTGGAGGCCGCATCTTTTACCCATACGATGTTCCTGACTATGCG
GGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGT
TCCAGATTACGCTGCTCATGGCGGACACCGGTCCACGTGA
MASISEPVTFREFCPLYYLLNAIPTKIQKGFRSIVVYLTALDTNGDYIAV
GSSIGMLYLHCRHLNQMRKYNFEGKTESITVVKLLSCFDDLVAAGTASGR
VAVFQLVSSLPGRNKQLRRFDVTGIHKNSITALAWSPNGMKLFSGDDKGK
IVYSSLDLDQGLCNSQLVLEEPSSIVQLDYSQKVLLVSTLQRSLLFYTEE
KSVRQIGTQPRKSTGKFGACFIPGLCKQSDLTLYASRPGLRLWKADVHGT
VQATFILKDAFAGGVKPFELHPRLESPNSGSCSLPERHLGLVSCFFQEGW
VLSWNEYSIYLLDTVNQATIAGLEGSGDIVSVSCTENEIFFLKGDRNIIR
ISSRPEGLTSTVRDGLEMSGCSERVHVQQAEKLPGATVSETRLRGSSMAS
SVASEPRSRSSSLNSTDSGSGLLPPGLQATPELGKGSQPLSQRFNAISSE
DFDQELVVKPIKVKRKKKKKKTEGGSRSTCHSSLESTPCSEFPGDSPQSL
NTDLLSMTSSVLGSSVDQLSAESPDQESSFNGEVNGVPQENTDPETFNVL
EVSGSMPDSLAEEDDIRTEMPHCHHAHGRELLNGAREDVGGSDVTGLGDE
PCPADDGPNSTQLPFQEQDSSPGAHDGEDIQPIGPQSTFCEVPLLNSLTV
PSSLSWAPSAEQWLPGTRADEGSPVEPSQEQDILTSMEASGHLSTNLWHA
VTDDDTGQKEIPISERVLGSVGGQLTPVSALAASTHKPWLEQPPRDQTLT
SSDEEDIYAHGLPSSSSETSVTELGPSCSQQDLSRLGAEDAGLLKPDQFA
ESWMGYSGPGYGILSLVVSEKYIWCLDYKGGLFCSALPGAGLRWQKFEDA
VQQVAVSPSGALLWKIEQKSNRAFACGKVTIKGKRHWYEALPQAVFVALS
DDTAWIIRTSGDLYLQTGLSVDRPCARAVKVDCPYPLSQITARNNVVWAL
TEQRALLYREGVSSFCPEGEQWKCDIVSERQALEPVCITLGDQQTLWALD
IHGNLWFRTGIISKKPQGDDDHWWQVSITDYVVFDQCSLFQTIIHATHSV
ATAAQAPVEKVADKLRMAFWSQQLQCQPSLLGVNNSGVWISSGKNEFHVA
KGSLIGTYWNHVVPRGTASATKWAFVLASAAPTKEGSFLWLCQSSKDLCS
VSAQSAQSRPSTVQLPPEAEMRAYAACQDALWALDSLGQVFIRTLSKSCP
TGMHWTRLDLSQLGAVKLTSLACGNQHIWACDSRGGVYFRVGTQPLNPSL
MLPAWIMIEPPVQVSRSYPAFLYKVVSSATMDLHRGGGRIFYPYDVPDYA
GYPYDVPDYAGSYPYDVPDYAAHGGHRST*

Index