Stock Number Hs1207

Human Gene: WDR45


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
WDR45 WD Repeat Domain 45 HGNC:28912 Xp11.23 CG11975 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_02631 BC000464.2 pUASgHA.attB NM_001029896.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO84770

Sequences

DNA sequence (1269 bp) Protein sequence (423 aa)
ATGACTCAACAGCCACTTCGAGGAGTGACCAGCCTGCGTTTCAACCAAGA
CCAAAGCTGCTTTTGCTGCGCCATGGAGACAGGTGTGCGCATCTACAACG
TGGAGCCCTTGATGGAGAAGGGGCATCTGGACCACGAGCAGGTGGGCAGC
ATGGGCTTGGTGGAGATGCTGCACCGCTCCAACCTTCTGGCCTTGGTGGG
CGGTGGTAGTAGTCCCAAGTTCTCAGAGATCTCAGTGCTGATCTGGGACG
ATGCCCGGGAGGGCAAGGACTCCAAGGAGAAGCTGGTGCTGGAGTTCACC
TTCACCAAGCCAGTGCTTTCTGTGCGCATGCGCCATGACAAGATCGTGAT
CGTGCTGAAGAACCGCATCTATGTGTACTCCTTCCCCGACAATCCCCGAA
AGCTGTTTGAGTTTGATACCCGGGACAACCCCAAGGGGCTCTGTGACCTC
TGCCCCAGCCTGGAGAAGCAACTGCTAGTGTTCCCGGGACACAAGTGTGG
GAGTCTGCAACTTGTGGACCTGGCGAGCACAAAGCCTGGCACCTCGTCTG
CTCCATTCACGATCAATGCACATCAGAGTGACATAGCCTGTGTGTCTCTA
AACCAGCCAGGCACTGTAGTGGCCTCAGCCTCCCAGAAGGGTACCCTTAT
TCGCCTCTTTGACACACAATCCAAGGAGAAACTGGTGGAGCTGCGCCGAG
GCACTGACCCTGCCACCCTCTACTGCATTAACTTCAGCCACGACTCCTCC
TTCCTCTGCGCTTCCAGTGATAAGGGTACTGTCCATATCTTTGCTCTCAA
GGATACCCGCCTCAACCGCCGCTCCGCGCTGGCTCGCGTGGGCAAGGTGG
GGCCTATGATTGGGCAGTACGTGGACTCTCAGTGGAGCCTGGCGAGCTTC
ACTGTGCCTGCTGAGTCAGCTTGCATCTGCGCCTTCGGTCGCAATACTTC
CAAGAACGTCAACTCTGTCATTGCCATCTGCGTAGATGGGACCTTCCACA
AATATGTCTTCACTCCTGATGGAAACTGCAACAGAGAGGCTTTCGACGTG
TACCTTGACATCTGTGATGATGATGACTTTTACCCAGCTTTCTTGTACAA
AGTGGTGAGCTCCGCCACCATGGATCTCCACCGCGGTGGAGGCCGCATCT
TTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCG
GACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTGCTCATGG
CGGACACCGGTCCACGTGA
MTQQPLRGVTSLRFNQDQSCFCCAMETGVRIYNVEPLMEKGHLDHEQVGS
MGLVEMLHRSNLLALVGGGSSPKFSEISVLIWDDAREGKDSKEKLVLEFT
FTKPVLSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFDTRDNPKGLCDL
CPSLEKQLLVFPGHKCGSLQLVDLASTKPGTSSAPFTINAHQSDIACVSL
NQPGTVVASASQKGTLIRLFDTQSKEKLVELRRGTDPATLYCINFSHDSS
FLCASSDKGTVHIFALKDTRLNRRSALARVGKVGPMIGQYVDSQWSLASF
TVPAESACICAFGRNTSKNVNSVIAICVDGTFHKYVFTPDGNCNREAFDV
YLDICDDDDFYPAFLYKVVSSATMDLHRGGGRIFYPYDVPDYAGYPYDVP
DYAGSYPYDVPDYAAHGGHRST*

Index