Stock Number Hs1205

Human Gene: WDFY1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
WDFY1 WD Repeat And FYVE Domain Containing 1 HGNC:20451 2q36.1 Wdfy2 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_03833 BC040525.1 pUASgHA.attB NM_020830.4 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33NO84769 FBti0205232

Sequences

DNA sequence (1419 bp) Protein sequence (473 aa)
ATGGCGGCCGAAATCCACTCCAGGCCGCAGAGCAGCCGCCCGGTGCTGCT
GAGCAAGATCGAGGGGCACCAGGACGCCGTCACGGCCGCGCTGCTCATCC
CCAAGGAGGACGGCGTGATCACGGCCAGCGAGGACAGAACCATCCGGGTA
TGGCTGAAAAGAGACAGTGGTCAATACTGGCCCAGCATTTACCACACAAT
GGCCTCTCCTTGCTCTGCTATGGCTTACCATCATGACAGCAGACGGATAT
TTGTGGGCCAGGATAATGGAGCTGTAATGGAATTTCACGTTTCTGAAGAT
TTTAATAAAATGAACTTTATCAAGACCTACCCAGCTCATCAGAACCGGGT
GTCTGCGATTATCTTCAGCTTGGCCACAGAGTGGGTGATCAGTACCGGCC
ACGACAAGTGTGTGAGCTGGATGTGCACGCGGAGCGGGAACATGCTCGGG
AGGCACTTCTTCACGTCCTGGGCTTCGTGTCTGCAATATGACTTTGACAC
TCAGTATGCTTTCGTTGGTGATTATTCTGGGCAGATCACCCTGCTGAAGC
TTGAACAGAACACGTGTTCAGTCATCACAACCCTCAAAGGACATGAAGGT
AGTGTCGCCTGCCTCTGGTGGGACCCTATTCAGCGGTTACTCTTCTCAGG
AGCATCTGACAACAGCATCATCATGTGGGACATCGGAGGAAGGAAAGGCC
GGACGCTGTTACTTCAGGGCCATCATGACAAGGTGCAGTCGCTGTGCTAC
CTTCAGCTCACCAGGCAGCTCGTCTCCTGTTCCTCGGACGGCGGAATTGC
AGTGTGGAACATGGATGTTAGCAGAGAAGAGGCTCCTCAGTGGTTGGAAA
GTGATTCTTGTCAGAAATGTGAGCAGCCATTTTTCTGGAACATAAAGCAG
ATGTGGGACACCAAGACGCTGGGGCTAAGACAACATCACTGCAGGAAATG
CGGGCAGGCTGTCTGCGGGAAGTGCAGCAGCAAGCGCTCAAGTTACCCAG
TCATGGGCTTCGAGTTCCAAGTCCGGGTTTGTGATTCTTGTTACGACTCC
ATCAAAGATGAAGATCGGACTTCTCTAGCGACCTTTCATGAAGGAAAACA
TAACATTTCCCACATGTCCATGGACATTGCCAGGGGACTGATGGTGACCT
GTGGGACCGACCGCATTGTAAAGATCTGGGACATGACACCTGTGGTGGGC
TGCAGTCTGGCGACTGGGTTTTCTCCGCACTACCCAGCTTTCTTGTACAA
AGTGGTGAGCTCCGCCACCATGGATCTCCACCGCGGTGGAGGCCGCATCT
TTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCG
GACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTGCTCATGG
CGGACACCGGTCCACGTGA
MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV
WLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGAVMEFHVSED
FNKMNFIKTYPAHQNRVSAIIFSLATEWVISTGHDKCVSWMCTRSGNMLG
RHFFTSWASCLQYDFDTQYAFVGDYSGQITLLKLEQNTCSVITTLKGHEG
SVACLWWDPIQRLLFSGASDNSIIMWDIGGRKGRTLLLQGHHDKVQSLCY
LQLTRQLVSCSSDGGIAVWNMDVSREEAPQWLESDSCQKCEQPFFWNIKQ
MWDTKTLGLRQHHCRKCGQAVCGKCSSKRSSYPVMGFEFQVRVCDSCYDS
IKDEDRTSLATFHEGKHNISHMSMDIARGLMVTCGTDRIVKIWDMTPVVG
CSLATGFSPHYPAFLYKVVSSATMDLHRGGGRIFYPYDVPDYAGYPYDVP
DYAGSYPYDVPDYAAHGGHRST*

Index