Stock Number Hs1204

Human Gene: DYNC1I2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
DYNC1I2 Dynein Cytoplasmic 1 Intermediate Chain 2 HGNC:2964 2q31.1 sw X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_10787 BC015038.2 pUASgHA.attB NM_001271789.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO84768

Sequences

DNA sequence (2025 bp) Protein sequence (675 aa)
ATGTCAGACAAAAGTGAATTAAAGGCTGAGTTGGAACGTAAGAAGCAGCG
ACTGGCCCAAATCAGAGAGGAAAAGAAGAGAAAAGAAGAAGAAAGGAAAA
AAAAAGAAACAGACCAGAAGAAGGAAGCTGTTGCTCCTGTGCAAGAAGAA
TCAGATCTTGAAAAAAAAAGGAGAGAAGCTGAAGCATTGCTTCAAAGCAT
GGGGCTAACTCCAGAATCCCCCATTGTCCCTCCTCCTATGTCTCCATCCT
CCAAATCTGTGAGCACTCCAAGTGAAGCTGGAAGCCAAGACTCTGGAGAT
GGCGCCGTGGGATCTAGACGAGGACCTATTAAACTTGGAATGGCTAAAAT
CACGCAAGTCGACTTTCCTCCTCGAGAAATTGTCACGTATACAAAGGAAA
CTCAGACTCCAGTTATGGCTCAACCCAAAGAAGATGAAGAGGAAGATGAT
GATGTAGTGGCTCCTAAACCACCTATTGAACCTGAAGAAGAGAAAACTTT
AAAGAAAGATGAGGAAAATGATAGTAAAGCTCCCCCTCATGAGCTGACTG
AAGAAGAAAAGCAACAAATCTTGCACTCTGAGGAATTTTTAAGTTTCTTT
GACCATTCTACAAGAATTGTAGAAAGAGCTCTTTCTGAGCAGATTAACAT
CTTCTTTGACTATAGTGGGAGAGATTTGGAAGACAAAGAAGGAGAGATTC
AAGCAGGTGCTAAACTGTCATTAAATCGACAATTTTTTGACGAACGTTGG
TCAAAGCATCGGGTGGTTAGTTGTTTGGATTGGTCATCTCAGTATCCGGA
GTTACTCGTGGCTTCCTATAACAACAATGAAGATGCCCCTCATGAGCCTG
ATGGTGTGGCCCTTGTATGGAATATGAAATACAAAAAAACTACCCCAGAG
TATGTGTTTCACTGCCAGTCAGCTGTGATGTCTGCCACATTTGCAAAATT
TCATCCAAATCTTGTTGTTGGTGGTACATATTCAGGCCAAATTGTGCTTT
GGGATAACCGTAGCAATAAAAGAACTCCAGTGCAAAGAACTCCACTGTCA
GCAGCTGCACACACACACCCTGTATATTGTGTAAATGTTGTTGGAACACA
AAATGCTCACAATCTGATTAGCATCTCTACTGATGGAAAAATTTGTTCAT
GGAGTCTGGACATGCTTTCCCATCCACAGGATAGCATGGAGTTGGTTCAT
AAACAGTCAAAAGCAGTAGCTGTGACATCTATGTCCTTCCCTGTTGGAGA
TGTCAACAACTTTGTTGTTGGGAGTGAAGAAGGTTCTGTGTACACAGCAT
GCCGCCATGGCAGCAAAGCTGGAATCAGTGAGATGTTTGAGGGGCATCAA
GGACCAATCACTGGCATCCATTGTCATGCAGCTGTTGGAGCAGTAGACTT
CTCACATCTTTTTGTCACTTCATCGTTTGACTGGACAGTAAAGCTTTGGA
CAACTAAGAATAACAAGCCTTTGTATTCATTTGAAGATAATGCAGACTAT
GTTTATGATGTTATGTGGTCACCTACCCACCCAGCCCTGTTTGCCTGTGT
GGATGGCATGGGGAGATTGGATTTGTGGAATCTCAATAATGACACAGAGG
TACCAACTGCCAGCATTTCTGTGGAGGGTAATCCTGCTCTTAATCGTGTG
AGATGGACCCATTCTGGCAGAGAGATTGCTGTGGGTGATTCTGAAGGACA
GATTGTTATATACGATGTGGGAGAGCAGATTGCTGTTCCCCGCAATGATG
AATGGGCACGGTTTGGCCGAACACTTGCAGAAATTAATGCAAACCGAGCT
GATGCAGAGGAGGAAGCAGCTACCCGAATACCTGCTTACCCAGCTTTCTT
GTACAAAGTGGTGAGCTCCGCCACCATGGATCTCCACCGCGGTGGAGGCC
GCATCTTTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGAC
GTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTGC
TCATGGCGGACACCGGTCCACGTGA
MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEE
SDLEKKRREAEALLQSMGLTPESPIVPPPMSPSSKSVSTPSEAGSQDSGD
GAVGSRRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEEDD
DVVAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFF
DHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERW
SKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKTTPE
YVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLS
AAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVH
KQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQ
GPITGIHCHAAVGAVDFSHLFVTSSFDWTVKLWTTKNNKPLYSFEDNADY
VYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRV
RWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINANRA
DAEEEAATRIPAYPAFLYKVVSSATMDLHRGGGRIFYPYDVPDYAGYPYD
VPDYAGSYPYDVPDYAAHGGHRST*

Index