Stock Number Hs1201

Human Gene: WDR5


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
WDR5 WD Repeat Domain 5 HGNC:12757 9q34.2 wds X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_07746 BC001635.1 pUASgHA.attB BC001635.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO84767

Sequences

DNA sequence (1191 bp) Protein sequence (397 aa)
ATGGCGACGGAGGAGAAGAAGCCCGAGACCGAGGCCGCCAGAGCACAGCC
AACCCCTTCGTCATCCGCCACTCAGAGCAAGCCTACACCTGTGAAGCCAA
ACTATGCTCTAAAGTTCACCCTTGCTGGCCACACCAAAGCAGTGTCCTCC
GTGAAATTCAGCCCGAATGGAGAGTGGCTGGCAAGTTCATCTGCTGATAA
ACTTATTAAAATTTGGGGCGCGTATGATGGGAAATTTGAGAAAACCATAT
CTGGTCACAAGCTGGGAATATCCGATGTAGCCTGGTCGTCAGATTCTAAC
CTTCTTGTTTCTGCCTCAGATGACAAAACCTTGAAGATATGGGACGTGAG
CTCGGGCAAGTGTCTGAAAACCCTGAAGGGACACAGTAATTATGTCTTTT
GCTGCAACTTCAATCCCCAGTCCAACCTTATTGTCTCAGGATCCTTTGAC
GAAAGCGTGAGGATATGGGATGTGAAAACAGGGAAGTGCCTCAAGACTTT
GCCAGCTCACTCGGATCCAGTCTCGGCCGTTCATTTTAATCGTGATGGAT
CCTTGATAGTTTCAAGTAGCTATGATGGTCTCTGTCGCATCTGGGACACC
GCCTCGGGCCAGTGCCTGAAGACGCTCATCGATGACGACAACCCCCCCGT
GTCTTTTGTGAAGTTCTCCCCGAACGGCAAATACATCCTGGCCGCCACGC
TGGACAACACTCTGAAGCTCTGGGACTACAGCAAGGGGAAGTGCCTGAAG
ACGTACACTGGCCACAAGAATGAGAAATACTGCATATTTGCCAATTTCTC
TGTTACTGGTGGGAAGTGGATTGTGTCTGGCTCAGAGGATAACCTTGTTT
ACATCTGGAACCTTCAGACGAAAGAGATTGTACAGAAACTACAAGGCCAC
ACAGATGTCGTGATCTCAACAGCTTGTCACCCAACAGAAAACATCATCGC
CTCTGCTGCGCTAGAAAATGACAAAACAATTAAACTGTGGAAGAGTGACT
GCTACCCAGCTTTCTTGTACAAAGTGGTGAGCTCCGCCACCATGGATCTC
CACCGCGGTGGAGGCCGCATCTTTTACCCATACGATGTTCCTGACTATGC
GGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACG
TTCCAGATTACGCTGCTCATGGCGGACACCGGTCCACGTGA
MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSS
VKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN
LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFD
ESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDT
ASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLK
TYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGH
TDVVISTACHPTENIIASAALENDKTIKLWKSDCYPAFLYKVVSSATMDL
HRGGGRIFYPYDVPDYAGYPYDVPDYAGSYPYDVPDYAAHGGHRST*

Index