Stock Number Hs1199

Human Gene: DCAF8


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
DCAF8 DDB1 And CUL4 Associated Factor 8 HGNC:24891 1q23.2 CG8001 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_03151 BC099709.1 pUASgHA.attB NR_028103.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO84766

Sequences

DNA sequence (1980 bp) Protein sequence (660 aa)
ATGTCCAGCAAAGGGAGCAGCACAGATGGCAGAACAGACTTAGCTAATGG
AAGCCTGTCTAGCAGTCCAGAGGAGATGTCTGGAGCTGAAGAGGGGAGGG
AGACATCCTCAGGCATTGAAGTGGAGGCCTCAGACCTGAGTTTGAGCTTG
ACTGGGGATGATGGTGGCCCCAACCGCACCAGCACAGAAAGTCGAGGCAC
AGACACAGAGAGCTCAGGTGAAGATAAGGACTCTGACAGCATGGAGGACA
CTGGTCATTACTCCATTAATGATGAAAATCGAGTCCATGACCGCTCAGAG
GAAGAGGAAGAGGAGGAAGAAGAGGAGGAAGAAGAGCAGCCTCGGCGCCG
TGTACAGCGCAAGCGGGCTAACCGTGACCAGGACTCATCAGATGATGAGC
GGGCCCTAGAGGACTGGGTGTCCTCAGAAACATCAGCTCTACCCCGACCT
CGCTGGCAAGCCCTCCCTGCCCTTCGGGAGCGGGAGCTGGGTTCAAGTGC
CCGCTTTGTCTATGAGGCCTGTGGGGCAAGAGTCTTTGTGCAGCGTTTCC
GCCTGCAGCATGGGCTTGAGGGCCATACTGGTTGTGTCAATACCCTGCAC
TTTAACCAGCGCGGCACCTGGCTGGCCAGTGGCAGCGATGACCTGAAGGT
GGTGGTGTGGGATTGGGTACGGCGGCAGCCAGTACTGGACTTTGAGAGTG
GCCACAAAAGTAATGTGTTCCAGGCCAAGTTTCTTCCTAACAGTGGTGAT
TCTACTCTGGCCATGTGTGCCCGTGACGGGCAGGTTCGAGTAGCAGAACT
GTCTGCCACACAGTGTTGCAAGAATACAAAACGTGTGGCCCAGCACAAGG
GAGCGTCCCACAAGTTGGCACTGGAACCAGACTCTCCCTGTACGTTCTTA
TCTGCAGGTGAAGATGCAGTTGTTTTCACCATTGACCTGAGACAAGACCG
CCCAGCGTCGAAACTGGTGGTGACAAAAGAGAAAGAGAAGAAAGTGGGGC
TGTATACGATCTATGTGAATCCTGCCAATACCCACCAGTTTGCAGTGGGT
GGACGAGATCAGTTTGTAAGGATTTATGACCAGAGGAAAATTGATGAGAA
TGAGAACAATGGAGTACTCAAGAAGTTCTGTCCTCATCACCTGGTGAACA
GTGAGTCCAAAGCAAACATCACCTGTCTTGTGTACAGCCACGACGGCACA
GAGCTCCTGGCCAGTTACAATGATGAAGACATTTACCTCTTCAACTCCTC
TCACAGTGATGGGGCCCAGTATGTTAAGAGATACAAGGGCCACAGAAATA
ATGCCACAGTAAAAGGCGTCAATTTCTATGGCCCCAAGAGTGAGTTTGTG
GTGAGCGGTAGTGACTGTGGGCACATCTTCCTCTGGGAGAAATCATCCTG
CCAGATTATTCAGTTCATGGAGGGGGACAAGGGAGGCGTGGTAAACTGTC
TTGAGCCCCACCCTCACCTGCCTGTGCTGGCAACCAGTGGCCTAGACCAT
GATGTGAAGATCTGGGCACCCACAGCTGAAGCTTCCACTGAGCTGACAGG
GTTAAAAGATGTGATTAAGAAGAACAAGCGGGAGCGGGATGAAGATAGCT
TGCACCAAACTGACCTGTTTGATAGTCACATGCTGTGGTTCCTTATGCAT
CACCTGAGACAGAGACGCCATCACCGGCGCTGGCGAGAACCTGGGGTTGG
GGCCACAGACGCGGACTCTGATGAGTCTCCCAGCTCCTCAGACACATCGG
ACGAGGAGGAGGGCCCTGACCGGGTGCAGTGCATGCCATCTTACCCAGCT
TTCTTGTACAAAGTGGTGAGCTCCGCCACCATGGATCTCCACCGCGGTGG
AGGCCGCATCTTTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCT
ATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTAC
GCTGCTCATGGCGGACACCGGTCCACGTGA
MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSL
TGDDGGPNRTSTESRGTDTESSGEDKDSDSMEDTGHYSINDENRVHDRSE
EEEEEEEEEEEEQPRRRVQRKRANRDQDSSDDERALEDWVSSETSALPRP
RWQALPALRERELGSSARFVYEACGARVFVQRFRLQHGLEGHTGCVNTLH
FNQRGTWLASGSDDLKVVVWDWVRRQPVLDFESGHKSNVFQAKFLPNSGD
STLAMCARDGQVRVAELSATQCCKNTKRVAQHKGASHKLALEPDSPCTFL
SAGEDAVVFTIDLRQDRPASKLVVTKEKEKKVGLYTIYVNPANTHQFAVG
GRDQFVRIYDQRKIDENENNGVLKKFCPHHLVNSESKANITCLVYSHDGT
ELLASYNDEDIYLFNSSHSDGAQYVKRYKGHRNNATVKGVNFYGPKSEFV
VSGSDCGHIFLWEKSSCQIIQFMEGDKGGVVNCLEPHPHLPVLATSGLDH
DVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDLFDSHMLWFLMH
HLRQRRHHRRWREPGVGATDADSDESPSSSDTSDEEEGPDRVQCMPSYPA
FLYKVVSSATMDLHRGGGRIFYPYDVPDYAGYPYDVPDYAGSYPYDVPDY
AAHGGHRST*

Index