Stock Number Hs1181

Human Gene: KIAA1109


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
KIAA1109 KIAA1109 HGNC:26953 4q27 tweek 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection IOH26422 pGW-HA.attB BC045783.1 Reference Closed

Stocks

Docking Site DGRC BDSC FBti
VK33NO84765

Sequences

DNA sequence (576 bp) Protein sequence (192 aa)
ATGCAGCTTGACTTTAAATCCATTCATGTTCAAGAACCACAGGAGCCTTC
ATTACAGGATGCCAGCCTGAAGCCAAAAGTAGAATGTAGTGTGGTGACAG
AGTTCACTGACCACATTTGTGTGACTATGGATGCTGAGCTCATCATGTTT
CTTCATGATTTAGTATCAGCTTATCTTAAAGAAAAAGAAAAAGCCATCTT
TCCACCTCGGATTTTATCTACTCGACCAGGACAAAAAAGTCCAATTATTA
TACATGACGACAATTCCTCTGATAAAGATAGAGAAGATAGCATCACTTAT
ACTACTGTGGACTGGAGAGATTTTATGTGCAATACATGGCATCTAGAACC
TACTCTTAGATTAATTTCTTGGACTGGAAGAAAGATTGATCCAGTAGGTG
TTGATTATATTCTTCAAAAATTGGGCTTTCATCATGCTAGGACTACTATT
CCTAAATGGCTTCAAAGAGGAGTCATGGATCCACTGGACAAGGTTCTGTC
AGTTCTTATCAAAAAGCTCGGTACTGCACTACAGGATGAAAAGGAAAAGA
AAGGCAAAGACAAAGAAGAACACTAA
MQLDFKSIHVQEPQEPSLQDASLKPKVECSVVTEFTDHICVTMDAELIMF
LHDLVSAYLKEKEKAIFPPRILSTRPGQKSPIIIHDDNSSDKDREDSITY
TTVDWRDFMCNTWHLEPTLRLISWTGRKIDPVGVDYILQKLGFHHARTTI
PKWLQRGVMDPLDKVLSVLIKKLGTALQDEKEKKGKDKEEH*

Index