Stock Number Hs1179

Human Gene: ITSN2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ITSN2 Intersectin 2 HGNC:6184 2p23.3 Dap160 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_10457 pGW-HA.attB BC146779.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33NO84764

Sequences

DNA sequence (5241 bp) Protein sequence (1747 aa)
ATGGCTCAGTTTCCCACAGCTATGAATGGAGGGCCAAACATGTGGGCTAT
TACCTCTGAAGAACGTACTAAGCATGACAGGCAGTTTGATAACCTCAAAC
CTTCAGGAGGTTACATAACAGGTGATCAAGCACGTAATTTTTTCCTACAA
TCAGGTCTGCCGGCCCCTGTTTTAGCTGAAATATGGGCTTTATCAGACCT
AAACAAGGATGGGAAGATGGATCAGCAAGAGTTCTCCATAGCTATGAAAC
TCATCAAACTGAAGCTTCAAGGCCAACAGTTGCCTGTGGTTCTCCCTCCT
ATTATGAAGCAACCCCCTATGTTTTCTCCATTAATTTCTGCTCGTTTTGG
AATGGGAAGCATGCCCAATCTGTCCATTCCTCAGCCATTGCCTCCAGCTG
CACCTATAACATCATTGTCTTCTGCGACTTCAGGGACCAACCTTCCTCCC
TTAATGATGCCCACTCCCCTAGTGCCTTCTGTTAGCACATCATCATTACC
AAATGGAACCGCCAGTCTCATTCAGCCTTTACCCATTCCTTATTCTTCTT
CAACATTGCCTCATGGGTCATCTTATAGTCTGATGATGGGAGGATTTGGA
GGTGCTAGTATACAGAAAGCGCAGTCTCTGATTGATTTAGGATCTAGTAG
CTCAACTTCCTCGACTGCTTCACTCTCAGGGAACTCACCCAAGACTGGGA
CCTCAGAGTGGGCAGTTCCTCAGCCTACAAGATTAAAATATCGGCAAAAA
TTTAATACTCTTGACAAAAGTATGAGTGGATATCTCTCAGGTTTTCAAGC
TAGAAATGCCCTTCTTCAGTCAAATCTTTCTCAAACTCAGCTGGCTACTA
TTTGGACTCTGGCTGACGTTGATGGTGATGGACAGCTAAAAGCAGAAGAG
TTTATTCTTGCAATGCACCTTACTGACATGGCCAAAGCTGGACAGCCATT
ACCACTGACTTTACCTCCTGAGCTTGTTCCTCCATCTTTCAGAGGAGGAA
AGCAAATTGATTCCATTAATGGAACTCTGCCTTCATATCAGAAAATGCAA
GAAGAGGAGCCTCAGAAGAAATTACCAGTTACTTTTGAGGACAAACGGAA
AGCCAACTATGAGCGAGGGAACATGGAGCTGGAAAAGCGACGCCAAGCCT
TGATGGAGCAGCAACAAAGGGAGGCAGAACGTAAAGCCCAGAAAGAAAAG
GAAGAGTGGGAACGAAAACAGAGAGAATTACAAGAACAAGAATGGAAGAA
ACAACTTGAATTAGAAAAACGCTTAGAGAAGCAACGGGAATTGGAGAGAC
AACGAGAGGAAGAAAGGAGAAAAGACATAGAAAGACGAGAGGCAGCAAAA
CAGGAACTTGAACGACAACGTCGCTTAGAATGGGAGAGAATTCGGCGACA
GGAGCTTCTCAATCAAAAGAATAGAGAACAAGAAGAAATTGTCAGGTTAA
ACTCTAAAAAGAAGAATCTTCATCTTGAGTTGGAAGCACTGAATGGCAAA
CATCAGCAGATCTCAGGCAGACTTCAGGATGTCCGACTCAAAAAGCAAAC
TCAAAAGACTGAGCTGGAAGTTCTGGATAAGCAGTGTGACTTGGAAATTA
TGGAAATCAAGCAACTTCAACAGGAACTTCAGGAATATCAGAATAAGCTT
ATCTATCTGGTACCTGAGAAGCAATTATTAAATGAAAGAATTAAAAACAT
GCAGTTCAGTAACACACCTGATTCAGGGGTCAGTTTACTTCATAAAAAAT
CATTAGAAAAGGAAGAATTATGCCAAAGACTTAAAGAACAGTTAGATGCT
CTTGAAAAAGAAACTGCATCTAAGCTGTCAGAAATGGATTCTTTTAACAA
TCAACTAAAGGAACTGAGAGAAACCTACAACACACAGCAGTTAGCCCTTG
AACAGCTTTATAAGATCAAACGTGACAAGTTGAAGGAAATTGAAAGGAAA
AGATTAGAACTAATGCAGAAAAAGAAACTAGAAGATGAGGCTGCAAGGAA
AGCAAAGCAAGGAAAAGAAAACTTATGGAAAGAAAATCTTAGAAAGGAGG
AAGAAGAAAAACAAAAGCGACTCCAGGAAGAAAAAACACAAGAAAAAATT
CAAGAAGAGGAACGGAAAGCTGAGGAGAAACAACGTAAGGATAAGGATAC
TTTGAAAGCTGAGGAGAAAAAACGTGAGACAGCTAGTGTTTTGGTGAATT
ATAGAGCATTATACCCCTTTGAAGCAAGGAACCATGATGAGATGAGTTTT
AATTCTGGAGATATAATTCAGGTTGATGAAAAAACCGTAGGAGAACCTGG
TTGGCTTTATGGTAGTTTTCAAGGAAATTTTGGCTGGTTTCCATGCAATT
ATGTAGAAAAAATGCCATCAAGTGAAAATGAAAAAGCTGTATCTCCAAAG
AAGGCCTTACTTCCTCCTACAGTTTCTTTATCTGCTACCTCAACTTCCTC
TGAACCACTTTCTTCAAATCAACCAGCATCAGTGACTGATTATCAAAATG
TATCTTTTTCAAACCTAACTGTAAATACATCATGGCAGAAAAAATCAGCC
TTCACTCGAACTGTGTCCCCTGGATCTGTATCACCTATTCATGGACAGGG
ACAAGTGGTAGAAAACTTAAAAGCACAGGCCCTTTGTTCCTGGACTGCAA
AGAAAGATAACCACTTGAACTTCTCAAAACATGACATTATTACTGTCTTG
GAGCAGCAAGAAAATTGGTGGTTTGGGGAGGTGCATGGAGGAAGAGGATG
GTTTCCCAAATCTTATGTCAAGATCATTCCTGGGAGTGAAGTAAAACGGG
AAGAACCAGAAGCTTTGTATGCAGCTGTAAATAAGAAACCTACCTCGGCA
GCCTATTCAGTTGGAGAAGAATATATTGCACTTTATCCATATTCAAGTGT
GGAACCTGGAGATTTGACTTTCACAGAAGGTGAAGAAATATTGGTGACCC
AGAAAGATGGAGAGTGGTGGACAGGAAGTATTGGAGATAGAAGTGGAATT
TTTCCATCAAACTATGTCAAACCAAAGGATCAAGAGAGTTTTGGGAGTGC
TAGCAAGTCTGGAGCATCAAATAAAAAACCTGAGATTGCTCAGGTAACTT
CAGCATATGTTGCTTCTGGTTCTGAACAACTTAGCCTTGCACCAGGACAG
TTAATATTAATTCTAAAGAAAAATACAAGTGGGTGGTGGCAAGGAGAGTT
ACAGGCCAGAGGAAAAAAGCGACAGAAAGGATGGTTTCCTGCCAGTCATG
TTAAACTTTTGGGTCCAAGTAGTGAAAGAGCCACACCTGCCTTTCATCCT
GTATGTCAGGTGATTGCTATGTATGACTATGCAGCAAATAATGAAGATGA
GCTCAGTTTCTCCAAGGGACAACTCATTAATGTTATGAACAAAGATGATC
CTGATTGGTGGCAAGGAGAGATCAACGGGGTGACTGGTCTCTTTCCTTCA
AACTACGTTAAGATGACGACAGACTCAGATCCAAGTCAACAGTGGTGTGC
TGATCTGCAAACCCTGGACACAATGCAGCCAATTGAGAGGAAAAGACAGG
GCTATATTCATGAGCTGATTCAGACCGAAGAGCGGTACATGGCTGACCTT
CAGCTCGTCGTCGAGGTTTTTCAGAAACGCATGGCAGAGTCAGGCTTTCT
CACTGAAGGGGAGATGGCCCTGATTTTTGTTAACTGGAAGGAGCTCATCA
TGTCCAACACAAAGCTGCTGAAGGCTTTGCGGGTGCGGAAGAAGACCGGG
GGCGAGAAGATGCCGGTGCAGATGATTGGGGACATCCTGGCCGCTGAGCT
GTCCCACATGCAGGCTTACATCAGGTTCTGCAGCTGCCAGCTTAATGGAG
CAGCTCTGTTACAGCAGAAGACAGATGAAGACACAGATTTCAAAGAATTT
TTAAAGAAGCTGGCATCTGACCCGCGGTGTAAAGGAATGCCCCTCTCCAG
CTTCCTGCTGAAACCCATGCAGAGGATCACCCGCTACCCACTGCTCATCA
GAAGTATTCTGGAGAACACCCCGGAGAGCCATGCAGACCATTCCTCCCTA
AAGCTGGCCCTCGAGCGGGCAGAGGAGCTGTGCTCTCAAGTGAATGAGGG
AGTTCGGGAGAAGGAAAACTCGGACCGACTGGAGTGGATCCAGGCGCACG
TGCAGTGTGAAGGCCTCGCGGAGCAACTTATTTTCAACTCTCTCACCAAC
TGCCTGGGGCCCCGGAAGCTCTTACACAGTGGGAAATTATACAAGACCAA
GAGCAACAAGGAACTGCACGGATTCCTCTTCAATGACTTCCTGCTTCTTA
CCTACATGGTCAAGCAGTTTGCTGTTTCCTCTGGCTCTGAGAAACTTTTC
AGCTCGAAGTCCAATGCTCAATTCAAAATGTATAAAACGCCCATTTTCCT
GAATGAAGTCTTGGTGAAACTGCCCACAGACCCTTCCAGCGATGAGCCTG
TCTTCCACATTTCCCACATTGATCGGGTCTACACCCTCCGAACAGACAAC
ATTAATGAGAGGACCGCCTGGGTGCAGAAGATCAAGGCGGCGTCTGAGCA
GTACATCGACACCGAGAAGAAGCAGCGTGAGAAAGCTTACCAAGCCCGCT
CCCAAAAGACTTCAGGCATTGGGCGCCTGATGGTGCATGTCATTGAAGCT
ACAGAATTAAAAGCCTGCAAACCAAATGGAAAGAGCAACCCATACTGTGA
AATCAGCATGGGCTCCCAGAGCTACACCACCAGGACCATCCAGGACACAC
TCAATCCCAAGTGGAATTTTAACTGCCAGTTCTTTATTAAGGATCTCTAC
CAAGACGTGCTGTGTCTCACCCTGTTTGACAGAGACCAGTTTTCACCAGA
TGATTTCCTGGGTCGTACTGAAATTCCAGTGGCAAAAATTCGAACAGAAC
AGGAAAGCAAAGGCCCTATGACCCGCCGACTGCTGCTGCATGAGGTCCCC
ACCGGGGAGGTCTGGGTCCGTTTTGACCTGCAGCTTTTTGAGCAAAAAAC
TCTCCTGTACCCAGCTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCT
ATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGC
GGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTA
CCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACT
ATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MAQFPTAMNGGPNMWAITSEERTKHDRQFDNLKPSGGYITGDQARNFFLQ
SGLPAPVLAEIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPP
IMKQPPMFSPLISARFGMGSMPNLSIPQPLPPAAPITSLSSATSGTNLPP
LMMPTPLVPSVSTSSLPNGTASLIQPLPIPYSSSTLPHGSSYSLMMGGFG
GASIQKAQSLIDLGSSSSTSSTASLSGNSPKTGTSEWAVPQPTRLKYRQK
FNTLDKSMSGYLSGFQARNALLQSNLSQTQLATIWTLADVDGDGQLKAEE
FILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKMQ
EEEPQKKLPVTFEDKRKANYERGNMELEKRRQALMEQQQREAERKAQKEK
EEWERKQRELQEQEWKKQLELEKRLEKQRELERQREEERRKDIERREAAK
QELERQRRLEWERIRRQELLNQKNREQEEIVRLNSKKKNLHLELEALNGK
HQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQQELQEYQNKL
IYLVPEKQLLNERIKNMQFSNTPDSGVSLLHKKSLEKEELCQRLKEQLDA
LEKETASKLSEMDSFNNQLKELRETYNTQQLALEQLYKIKRDKLKEIERK
RLELMQKKKLEDEAARKAKQGKENLWKENLRKEEEEKQKRLQEEKTQEKI
QEEERKAEEKQRKDKDTLKAEEKKRETASVLVNYRALYPFEARNHDEMSF
NSGDIIQVDEKTVGEPGWLYGSFQGNFGWFPCNYVEKMPSSENEKAVSPK
KALLPPTVSLSATSTSSEPLSSNQPASVTDYQNVSFSNLTVNTSWQKKSA
FTRTVSPGSVSPIHGQGQVVENLKAQALCSWTAKKDNHLNFSKHDIITVL
EQQENWWFGEVHGGRGWFPKSYVKIIPGSEVKREEPEALYAAVNKKPTSA
AYSVGEEYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGDRSGI
FPSNYVKPKDQESFGSASKSGASNKKPEIAQVTSAYVASGSEQLSLAPGQ
LILILKKNTSGWWQGELQARGKKRQKGWFPASHVKLLGPSSERATPAFHP
VCQVIAMYDYAANNEDELSFSKGQLINVMNKDDPDWWQGEINGVTGLFPS
NYVKMTTDSDPSQQWCADLQTLDTMQPIERKRQGYIHELIQTEERYMADL
QLVVEVFQKRMAESGFLTEGEMALIFVNWKELIMSNTKLLKALRVRKKTG
GEKMPVQMIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTDEDTDFKEF
LKKLASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTPESHADHSSL
KLALERAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLAEQLIFNSLTN
CLGPRKLLHSGKLYKTKSNKELHGFLFNDFLLLTYMVKQFAVSSGSEKLF
SSKSNAQFKMYKTPIFLNEVLVKLPTDPSSDEPVFHISHIDRVYTLRTDN
INERTAWVQKIKAASEQYIDTEKKQREKAYQARSQKTSGIGRLMVHVIEA
TELKACKPNGKSNPYCEISMGSQSYTTRTIQDTLNPKWNFNCQFFIKDLY
QDVLCLTLFDRDQFSPDDFLGRTEIPVAKIRTEQESKGPMTRRLLLHEVP
TGEVWVRFDLQLFEQKTLLYPAFLYKVVVPRSSYSLLSIGTSILGAPSGG
GATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index