Stock Number Hs1153

Human Gene: ABCA1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ABCA1 ATP Binding Cassette Subfamily A Member 1 HGNC:29 9q31.1 CG34120 X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Dharmacon MHS6278-213246308 pGW-HA.attB BC146856.1 Reference Closed

Stocks

Docking Site DGRC BDSC FBti
VK37NO84758 FBti0207935

Sequences

DNA sequence (6786 bp) Protein sequence (2262 aa)
ATGGCTTGTTGGCCTCAGCTGAGGTTGCTGCTGTGGAAGAACCTCACTTT
CAGAAGAAGACAAACATGTCAGCTGCTGCTGGAAGTGGCCTGGCCTCTAT
TTATCTTCCTGATCCTGATCTCTGTTCGGCTGAGCTACCCACCCTATGAA
CAACATGAATGCCATTTTCCAAATAAAGCCATGCCCTCTGCAGGAACACT
TCCTTGGGTTCAGGGGATTATCTGTAATGCCAACAACCCCTGTTTCCGTT
ACCCGACTCCTGGGGAGGCTCCCGGAGTTGTTGGAAACTTTAACAAATCC
ATTGTGGCTCGCCTGTTCTCAGATGCTCGGAGGCTTCTTTTATACAGCCA
GAAAGACACCAGCATGAAGGACATGCGCAAAGTTCTGAGAACATTACAGC
AGATCAAGAAATCCAGCTCAAACTTGAAGCTTCAAGATTTCCTGGTGGAC
AATGAAACCTTCTCTGGGTTCCTGTATCACAACCTCTCTCTCCCAAAGTC
TACTGTGGACAAGATGCTGAGGGCTGATGTCATTCTCCACAAGGTATTTT
TGCAAGGCTACCAGTTACATTTGACAAGTCTGTGCAATGGATCAAAATCA
GAAGAGATGATTCAACTTGGTGACCAAGAAGTTTCTGAGCTTTGTGGCCT
ACCAAGGGAGAAACTGGCTGCAGCAGAGCGAGTACTTCGTTCCAACATGG
ACATCCTGAAGCCAATCCTGAGAACACTAAACTCTACATCTCCCTTCCCG
AGCAAGGAGCTGGCTGAAGCCACAAAAACATTGCTGCATAGTCTTGGGAC
TCTGGCCCAGGAGCTGTTCAGCATGAGAAGCTGGAGTGACATGCGACAGG
AGGTGATGTTTCTGACCAATGTGAACAGCTCCAGCTCCTCCACCCAAATC
TACCAGGCTGTGTCTCGTATTGTCTGCGGGCATCCCGAGGGAGGGGGGCT
GAAGATCAAGTCTCTCAACTGGTATGAGGACAACAACTACAAAGCCCTCT
TTGGAGGCAATGGCACTGAGGAAGATGCTGAAACCTTCTATGACAACTCT
ACAACTCCTTACTGCAATGATTTGATGAAGAATTTGGAGTCTAGTCCTCT
TTCCCGCATTATCTGGAAAGCTCTGAAGCCGCTGCTCGTTGGGAAGATCC
TGTATACACCTGACACTCCAGCCACAAGGCAGGTCATGGCTGAGGTGAAC
AAGACCTTCCAGGAACTGGCTGTGTTCCATGATCTGGAAGGCATGTGGGA
GGAACTCAGCCCCAAGATCTGGACCTTCATGGAGAACAGCCAAGAAATGG
ACCTTGTCCGGATGCTGTTGGACAGCAGGGACAATGACCACTTTTGGGAA
CAGCAGTTGGATGGCTTAGATTGGACAGCCCAAGACATCGTGGCGTTTTT
GGCCAAGCACCCAGAGGATGTCCAGTCCAGTAATGGTTCTGTGTACACCT
GGAGAGAAGCTTTCAACGAGACTAACCAGGCAATCCGGACCATATCTCGC
TTCATGGAGTGTGTCAACCTGAACAAGCTAGAACCCATAGCAACAGAAGT
CTGGCTCATCAACAAGTCCATGGAGCTGCTGGATGAGAGGAAGTTCTGGG
CTGGTATTGTGTTCACTGGAATTACTCCAGGCAGCATTGAGCTGCCCCAT
CATGTCAAGTACAAGATCCGAATGGACATTGACAATGTGGAGAGGACAAA
TAAAATCAAGGATGGGTACTGGGACCCTGGTCCTCGAGCTGACCCCTTTG
AGGACATGCGGTACGTCTGGGGGGGCTTCGCCTACTTGCAGGATGTGGTG
GAGCAGGCAATCATCAGGGTGCTGACGGGCACCGAGAAGAAAACTGGTGT
CTATATGCAACAGATGCCCTATCCCTGTTACGTTGATGACATCTTTCTGC
GGGTGATGAGCCGGTCAATGCCCCTCTTCATGACGCTGGCCTGGATTTAC
TCAGTGGCTGTGATCATCAAGGGCATCGTGTATGAGAAGGAGGCACGGCT
GAAAGAGACCATGCGGATCATGGGCCTGGACAACAGCATCCTCTGGTTTA
GCTGGTTCATTAGTAGCCTCATTCCTCTTCTTGTGAGCGCTGGCCTGCTA
GTGGTCATCCTGAAGTTAGGAAACCTGCTGCCCTACAGTGATCCCAGCGT
GGTGTTTGTCTTCCTGTCCGTGTTTGCTGTGGTGACAATCCTGCAGTGCT
TCCTGATTAGCACACTCTTCTCCAGAGCCAACCTGGCAGCAGCCTGTGGG
GGCATCATCTACTTCACGCTGTACCTGCCCTACGTCCTGTGTGTGGCATG
GCGGGACTACGTGGGCTTCACACTCAAGATCTTCGCTAGCCTGCTGTCTC
CTGTGGCTTTTGGGTTTGGCTGTGAGTACTTTGCCCTTTTTGAGGAGCAG
GGCATTGGAGTGCAGTGGGACAACCTGTTTGAGAGTCCTGTGGAGGAAGA
TGGCTTCAATCTCACCACTTCGGTCTCCATGATGCTGTTTGACACCTTCC
TCTATGGGGTGATGACCTGGTACATTGAGGCTGTCTTTCCAGGCCAGTAC
GGAATTCCCAGGCCCTGGTATTTTCCTTGCACCAAGTCCTACTGGTTTGG
CGAGGAAAGTGATGAGAAGAGCCACCCTGGTTCCAACCAGAAGAGAATAT
CAGAAATCTGCATGGAGGAGGAACCCACCCACTTGAAGCTGGGCGTGTCC
ATTCAGAACCTGGTAAAAGTCTACCGAGATGGGATGAAGGTGGCTGTCGA
TGGCCTGGCACTGAATTTTTATGAGGGCCAGATCACCTCCTTCCTGGGCC
ACAATGGAGCGGGGAAGACGACCACCATGTCAATCCTGACCGGGTTGTTC
CCCCCGACCTCGGGCACCGCCTACATCCTGGGAAAAGACATTCGCTCTGA
GATGAGCACCATCCGGCAGAACCTGGGGGTCTGTCCCCAGCATAACGTGC
TGTTTGACATGCTGACTGTCGAAGAACACATCTGGTTCTATGCCCGCTTG
AAAGGGCTCTCTGAGAAGCACGTGAAGGCGGAGATGGAGCAGATGGCCCT
GGATGTTGGTTTGCCATCAAGCAAGCTGAAAAGCAAAACAAGCCAGCTGT
CAGGTGGAATGCAGAGAAAGCTATCTGTGGCCTTGGCCTTTGTCGGGGGA
TCTAAGGTTGTCATTCTGGATGAACCCACAGCTGGTGTGGACCCTTACTC
CCGCAGGGGAATATGGGAGCTGCTGCTGAAATACCGACAAGGCCGCACCA
TTATTCTCTCTACACACCACATGGATGAAGCGGACGTCCTGGGGGACAGG
ATTGCCATCATCTCCCATGGGAAGCTGTGCTGTGTGGGCTCCTCCCTGTT
TCTGAAGAACCAGCTGGGAACAGGCTACTACCTGACCTTGGTCAAGAAAG
ATGTGGAATCCTCCCTCAGTTCCTGCAGAAACAGTAGTAGCACTGTGTCA
TACCTGAAAAAGGAGGACAGTGTTTCTCAGAGCAGTTCTGATGCTGGCCT
GGGCAGCGACCATGAGAGTGACACGCTGACCATCGATGTCTCTGCTATCT
CCAACCTCATCAGGAAGCATGTGTCTGAAGCCCGGCTGGTGGAAGACATA
GGGCATGAGCTGACCTATGTGCTGCCATATGAAGCTGCTAAGGAGGGAGC
CTTTGTGGAACTCTTTCATGAGATTGATGACCGGCTCTCAGACCTGGGCA
TTTCTAGTTATGGCATCTCAGAGACGACCCTGGAAGAAATATTCCTCAAG
GTGGCCGAAGAGAGTGGGGTGGATGCTGAGACCTCAGATGGTACCTTGCC
AGCAAGACGAAACAGGCGGGCCTTCGGGGACAAGCAGAGCTGTCTTCGCC
CGTTCACTGAAGATGATGCTGCTGATCCAAATGATTCTGACATAGACCCA
GAATCCAGAGAGACAGACTTGCTCAGTGGGATGGATGGCAAAGGGTCCTA
CCAGGTGAAAGGCTGGAAACTTACACAGCAACAGTTTGTGGCCCTTTTGT
GGAAGAGACTGCTAATTGCCAGACGGAGTCGGAAAGGATTTTTTGCTCAG
ATTGTCTTGCCAGCTGTGTTTGTCTGCATTGCCCTTGTGTTCAGCCTGAT
CGTGCCACCCTTTGGCAAGTACCCCAGCCTGGAACTTCAGCCCTGGATGT
ACAACGAACAGTACACATTTGTCAGCAATGATGCTCCTGAGGACACGGGA
ACCCTGGAACTCTTAAACGCCCTCACCAAAGACCCTGGCTTCGGGACCCG
CTGTATGGAAGGAAACCCAATCCCAGACACGCCCTGCCAGGCAGGGGAGG
AAGAGTGGACCACTGCCCCAGTTCCCCAGACCATCATGGACCTCTTCCAG
AATGGGAACTGGACAATGCAGAACCCTTCACCTGCATGCCAGTGTAGCAG
CGACAAAATCAAGAAGATGCTGCCTGTGTGTCCCCCAGGGGCAGGGGGGC
TGCCTCCTCCACAAAGAAAACAAAACACTGCAGATATCCTTCAGGACCTG
ACAGGAAGAAACATTTCGGATTATCTGGTGAAGACGTATGTGCAGATCAT
AGCCAAAAGCTTAAAGAACAAGATCTGGGTGAATGAGTTTAGGTATGGCG
GCTTTTCCCTGGGTGTCAGTAATACTCAAGCACTTCCTCCGAGTCAAGAA
GTTAATGATGCCATCAAACAAATGAAGAAACACCTAAAGCTGGCCAAGGA
CAGTTCTGCAGATCGATTTCTCAACAGCTTGGGAAGATTTATGACAGGAC
TGGACACCAAAAATAATGTCAAGGTGTGGTTCAATAACAAGGGCTGGCAT
GCAATCAGCTCTTTCCTGAATGTCATCAACAATGCCATTCTCCGGGCCAA
CCTGCAAAAGGGAGAGAACCCTAGCCATTATGGAATTACTGCTTTCAATC
ATCCCCTGAATCTCACCAAGCAGCAGCTCTCAGAGGTGGCTCTGATGACC
ACATCAGTGGATGTCCTTGTGTCCATCTGTGTCATCTTTGCAATGTCCTT
CGTCCCAGCCAGCTTTGTCGTATTCCTGATCCAGGAGCGGGTCAGCAAAG
CAAAACACCTGCAGTTCATCAGTGGAGTGAAGCCTGTCATCTACTGGCTC
TCTAATTTTGTCTGGGATATGTGCAATTACGTTGTCCCTGCCACACTGGT
CATTATCATCTTCATCTGCTTCCAGCAGAAGTCCTATGTGTCCTCCACCA
ATCTGCCTGTGCTAGCCCTTCTACTTTTGCTGTATGGGTGGTCAATCACA
CCTCTCATGTACCCAGCCTCCTTTGTGTTCAAGATCCCCAGCACAGCCTA
TGTGGTGCTCACCAGCGTGAACCTCTTCATTGGCATTAATGGCAGCGTGG
CCACCTTTGTGCTGGAGCTGTTCACCGACAATAAGCTGAATAATATCAAT
GATATCCTGAAGTCCGTGTTCTTGATCTTCCCACATTTTTGCCTGGGACG
AGGGCTCATCGACATGGTGAAAAACCAGGCAATGGCTGATGCCCTGGAAA
GGTTTGGGGAGAATCGCTTTGTGTCACCATTATCTTGGGACTTGGTGGGA
CGAAACCTCTTCGCCATGGCCGTGGAAGGGGTGGTGTTCTTCCTCATTAC
TGTTCTGATCCAGTACAGATTCTTCATCAGGCCCAGACCTGTAAATGCAA
AGCTATCTCCTCTGAATGATGAAGATGAAGATGTGAGGCGGGAAAGACAG
AGAATTCTTGATGGTGGAGGCCAGAATGACATCTTAGAAATCAAGGAGTT
GACGAAGATATATAGAAGGAAGCGGAAGCCTGCTGTTGACAGGATTTGCG
TGGGCATTCCTCCTGGTGAGTGCTTTGGGCTCCTGGGAGTTAATGGGGCT
GGAAAATCATCAACTTTCAAGATGTTAACAGGAGATACCACTGTTACCAG
AGGAGATGCTTTCCTTAACAAAAATAGTATCTTATCAAACATCCATGAAG
TACATCAGAACATGGGCTACTGCCCTCAGTTTGATGCCATCACAGAGCTG
TTGACTGGGAGAGAACACGTGGAGTTCTTTGCCCTTTTGAGAGGAGTCCC
AGAGAAAGAAGTTGGCAAGGTTGGTGAGTGGGCGATTCGGAAACTGGGCC
TCGTGAAGTATGGAGAAAAATATGCTGGTAACTATAGTGGAGGCAACAAA
CGCAAGCTCTCTACAGCCATGGCTTTGATCGGCGGGCCTCCTGTGGTGTT
TCTGGATGAACCCACCACAGGCATGGATCCCAAAGCCCGGCGGTTCTTGT
GGAATTGTGCCCTAAGTGTTGTCAAGGAGGGGAGATCAGTAGTGCTTACA
TCTCATAGTATGGAAGAATGTGAAGCTCTTTGCACTAGGATGGCAATCAT
GGTCAATGGAAGGTTCAGGTGCCTTGGCAGTGTCCAGCATCTAAAAAATA
GGTTTGGAGATGGTTATACAATAGTTGTACGAATAGCAGGGTCCAACCCG
GACCTGAAGCCTGTCCAGGATTTCTTTGGACTTGCATTTCCTGGAAGTGT
TCTAAAAGAGAAACACCGGAACATGCTACAATACCAGCTTCCATCTTCAT
TATCTTCTCTGGCCAGGATATTCAGCATCCTCTCCCAGAGCAAAAAGCGA
CTCCACATAGAAGACTACTCTGTTTCTCAGACAACACTTGACCAAGTATT
TGTGAACTTTGCCAAGGACCAAAGTGATGATGACCACTTAAAAGACCTCT
CATTACACAAAAACCAGACAGTAGTGGACGTTGCAGTTCTCACATCTTTT
CTACAGGATGAGAAAGTGAAAGAAAGCTATGTATAG
MACWPQLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYE
QHECHFPNKAMPSAGTLPWVQGIICNANNPCFRYPTPGEAPGVVGNFNKS
IVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVD
NETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKS
EEMIQLGDQEVSELCGLPREKLAAAERVLRSNMDILKPILRTLNSTSPFP
SKELAEATKTLLHSLGTLAQELFSMRSWSDMRQEVMFLTNVNSSSSSTQI
YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNGTEEDAETFYDNS
TTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVN
KTFQELAVFHDLEGMWEELSPKIWTFMENSQEMDLVRMLLDSRDNDHFWE
QQLDGLDWTAQDIVAFLAKHPEDVQSSNGSVYTWREAFNETNQAIRTISR
FMECVNLNKLEPIATEVWLINKSMELLDERKFWAGIVFTGITPGSIELPH
HVKYKIRMDIDNVERTNKIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVV
EQAIIRVLTGTEKKTGVYMQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIY
SVAVIIKGIVYEKEARLKETMRIMGLDNSILWFSWFISSLIPLLVSAGLL
VVILKLGNLLPYSDPSVVFVFLSVFAVVTILQCFLISTLFSRANLAAACG
GIIYFTLYLPYVLCVAWRDYVGFTLKIFASLLSPVAFGFGCEYFALFEEQ
GIGVQWDNLFESPVEEDGFNLTTSVSMMLFDTFLYGVMTWYIEAVFPGQY
GIPRPWYFPCTKSYWFGEESDEKSHPGSNQKRISEICMEEEPTHLKLGVS
IQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLF
PPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARL
KGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGG
SKVVILDEPTAGVDPYSRRGIWELLLKYRQGRTIILSTHHMDEADVLGDR
IAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVS
YLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDI
GHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLK
VAEESGVDAETSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDP
ESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQ
IVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQYTFVSNDAPEDTG
TLELLNALTKDPGFGTRCMEGNPIPDTPCQAGEEEWTTAPVPQTIMDLFQ
NGNWTMQNPSPACQCSSDKIKKMLPVCPPGAGGLPPPQRKQNTADILQDL
TGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNTQALPPSQE
VNDAIKQMKKHLKLAKDSSADRFLNSLGRFMTGLDTKNNVKVWFNNKGWH
AISSFLNVINNAILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMT
TSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWL
SNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSIT
PLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTDNKLNNIN
DILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVG
RNLFAMAVEGVVFFLITVLIQYRFFIRPRPVNAKLSPLNDEDEDVRRERQ
RILDGGGQNDILEIKELTKIYRRKRKPAVDRICVGIPPGECFGLLGVNGA
GKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITEL
LTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNK
RKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLT
SHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNP
DLKPVQDFFGLAFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKR
LHIEDYSVSQTTLDQVFVNFAKDQSDDDHLKDLSLHKNQTVVDVAVLTSF
LQDEKVKESYV*

Index