Stock Number Hs1000

Human Gene: GPD1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
GPD1 glycerol-3-phosphate dehydrogenase 1 HGNC:4455 12q13.12 Gpdh1 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03054 pGW-HA.attB Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166181984753

Sequences

DNA sequence (1281 bp) Protein sequence (427 aa)
ATGGCTAGCAAGAAAGTCTGCATTGTAGGCTCCGGGAACTGGGGCTCAGC
CATCGCCAAGATCGTGGGTGGCAATGCAGCCCAGCTGGCACAGTTTGACC
CACGGGTGACCATGTGGGTATTTGAGGAAGACATTGGAGGCAAAAAGCTG
ACTGAGATCATCAACACGCAGCATGAGAATGTCAAATACCTGCCAGGGCA
CAAGTTGCCCCCAAATGTGGTGGCTGTCCCAGATGTGGTCCAGGCTGCAG
AGGATGCTGACATCCTGATCTTTGTGGTGCCCCATCAGTTCATCGGCAAG
ATCTGTGACCAGCTCAAGGGCCATCTGAAGGCAAACGCCACTGGCATATC
TCTTATTAAGGGGGTAGACGAGGGCCCCAATGGGCTGAAGCTCATCTCGG
AAGTGATTGGGGAGCGCCTCGGCATCCCCATGAGTGTGCTGATGGGGGCC
AACATTGCCAGCGAGGTGGCTGATGAGAAGTTCTGTGAGACAACCATTGG
CTGCAAGGACCCGGCCCAGGGACAACTCCTGAAAGAGCTGATGCAGACAC
CAAACTTCCGTATCACAGTGGTGCAAGAGGTGGACACAGTAGAGATCTGT
GGAGCCTTAAAGAATGTAGTGGCCGTGGGGGCTGGCTTCTGTGATGGCCT
GGGCTTTGGCGACAACACCAAGGCGGCAGTGATCCGGCTGGGACTCATGG
AGATGATAGCCTTCGCCAAGCTCTTCTGCAGTGGCCCTGTGTCCTCTGCC
ACCTTCTTGGAGAGCTGTGGTGTTGCTGACCTGATCACTACCTGCTATGG
AGGGCGGAACCGGAAAGTGGCTGAGGCCTTTGCGCGTACAGGAAAGTCCA
TTGAGCAGCTGGAGAAAGAGTTGCTGAATGGGCAGAAACTGCAGGGGCCC
GAGACAGCCCGGGAGCTATACAGCATCCTCCAGCACAAGGGCCTGGTAGA
CAAGTTTCCCTTGTTCATGGCTGTGTACAAGGTGTGCTACGAGGGCCAGC
CAGTGGGTGAATTCATCCACTGCCTGCAGAATCATCCAGAACATATGTGC
CCAACTTACTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACT
TAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTG
CTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGAT
GTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATC
CTATCCATATGACGTTCCAGATTACGCTTGA
MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKL
TEIINTQHENVKYLPGHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGK
ICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGA
NIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEIC
GALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSA
TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP
ETARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHMC
PTYLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYD
VPDYAGYPYDVPDYAGSYPYDVPDYA*

Index