Stock Number Hs0879

Human Gene: FAM76B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
FAM76B family with sequence similarity 76 member B HGNC:28492 11q21 CG4452 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO01887 pGW-HA.attB ENST00000398187.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166150684751

Sequences

DNA sequence (933 bp) Protein sequence (311 aa)
ATGGCGGCCTCGGCCCTGTACGCCTGCACCAAGTGTACCCAGCGTTATCC
TTTCGAGGAGCTCTCCCAGGGCCAGCAGCTCTGCAAGGAATGTCGGATTG
CACATCCTATTGTAAAATGTACTTACTGCAGATCAGAATTTCAACAAGAG
AGCAAAACTAACACAATTTGTAAGAAGTGTGCTCAAAATGTGAAGCAATT
TGGGACGCCCAAGCCTTGTCAGTACTGTAACATAATTGCAGCATTTATTG
GTACCAAGTGTCAGCGTTGCACAAATTCAGAAAAAAAGTATGGACCACCT
CAGACCTGTGAACAGTGCAAACAGCAATGTGCTTTTGATCGGAAGGAGGA
AGGAAGAAGAAAGGTTGATGGAAAGTTATTATGCTGGCTCTGTACTTTAT
CGTACAAAAGAGTTTTACAGAAGACGAAAGAACAAAGGAAGAGCCTGGGA
TCTTCACATTCAAATTCATCTTCTTCATCTCTTACTGAGAAAGACCAGCA
TCATCCAAAACATCATCACCACCATCATCACCATCACCATCGTCACAGCA
GTAGCCATCACAAAATCAGCAATCTAAGTCCAGAAGAAGAGCAGGGACTG
TGGAAACAGAGCCATAAATCCTCTGCAACAATTCAGAATGAAACTCCAAA
GAAAAAGCCCAAATTGGAATCTAAGCCATCTAATGGAGATAGGTGTATGT
ACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTA
CTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTAC
TGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACG
ATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGA
TCCTATCCATATGACGTTCCAGATTACGCTTGA
MAASALYACTKCTQRYPFEELSQGQQLCKECRIAHPIVKCTYCRSEFQQE
SKTNTICKKCAQNVKQFGTPKPCQYCNIIAAFIGTKCQRCTNSEKKYGPP
QTCEQCKQQCAFDRKEEGRRKVDGKLLCWLCTLSYKRVLQKTKEQRKSLG
SSHSNSSSSSLTEKDQHHPKHHHHHHHHHHRHSSSHHKISNLSPEEEQGL
WKQSHKSSATIQNETPKKKPKLESKPSNGDRCMYPTFLYKVVVPRSSYSL
LSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAG
SYPYDVPDYA*

Index