Stock Number Hs0794

Human Gene: ABCA2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ABCA2 ATP-Binding Cassette, Subfamily A, Member 2 HGNC:32 9q34.3 Eato 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Harvard PlasmID HsCD00399270 pGW-HA.attB NM_212533.2 Reference Closed

Stocks

Docking Site DGRC BDSC FBti
VK33NO84743 FBti0207924

Sequences

DNA sequence (7401 bp) Protein sequence (2467 aa)
ATGGGGAGAAAAACGAGCCGCGTGCAGCAGGGGCCGCCTCGGTCCCCTGC
CTGCTCCGCTCACGGCGAGCGTTCCTGGGGCCTCGAGTTTCCCCCCTTCC
GCTGGCTGCTCGGAATCGCGGGACGGACCCACCTGGCCGCCCTGCCTCCC
TTCCAGTGGGTCCTGGCCTTCGAGATCTTCATCCCCCTGGTGCTGTTCTT
TATCCTGCTGGGGCTGCGACAGAAGAAGCCCACCATCTCCGTGAAGGAAG
TCTCCTTCTACACAGCGGCGCCCCTGACGTCTGCCGGCATCCTGCCTGTC
ATGCAATCGCTGTGCCCGGACGGCCAGCGAGACGAGTTCGGCTTCCTGCA
GTACGCCAACTCCACGGTCACGCAGCTGCTTGAGCGCCTGGACCGCGTGG
TGGAGGAAGGCAACCTGTTTGACCCAGCGCGGCCCAGCCTGGGCTCAGAG
CTCGAGGCCCTACGCCAGCATCTGGAGGCCCTCAGTGCGGGCCCGGGCAC
CTCGGGGAGCCACCTGGACAGATCCACAGTGTCTTCCTTCTCTCTGGACT
CGGTGGCCAGAAACCCGCAGGAGCTCTGGCGTTTCCTGACGCAAAACTTG
TCGCTGCCCAATAGCACGGCCCAAGCACTCTTGGCCGCCCGTGTGGACCC
GCCCGAGGTCTACCACCTGCTCTTTGGTCCCTCATCTGCCCTGGATTCAC
AGTCTGGCCTCCACAAGGGTCAGGAGCCCTGGAGCCGCCTAGGGGGCAAT
CCCCTGTTCCGGATGGAGGAGCTGCTGCTGGCTCCTGCCCTCCTGGAGCA
GCTCACCTGCACGCCGGGCTCGGGGGAGCTGGGCCGGATCCTCACTGTGC
CTGAGAGTCAGAAGGGAGCCCTGCAGGGCTACCGGGATGCTGTCTGCAGT
GGGCAGGCTGCTGCGCGTGCCAGGCGCTTCTCTGGGCTGTCTGCTGAGCT
CCGGAACCAGCTGGACGTGGCCAAGGTCTCCCAGCAGCTGGGCCTGGATG
CCCCCAACGGCTCGGACTCCTCGCCACAGGCGCCACCCCCACGGAGGCTG
CAGGCGCTTCTGGGGGACCTGCTGGATGCCCAGAAGGTTCTGCAGGATGT
GGATGTCCTGTCGGCCCTGGCCCTGCTACTGCCCCAGGGTGCCTGCACTG
GCCGGACCCCCGGACCCCCAGCCAGTGGTGCGGGTGGGGCGGCCAATGGC
ACTGGGGCAGGGGCAGTCATGGGCCCCAACGCCACCGCTGAGGAGGGCGC
ACCCTCTGCTGCAGCACTGGCCACCCCGGACACGCTGCAGGGCCAGTGCT
CAGCCTTCGTACAGCTCTGGGCCGGCCTGCAGCCCATCTTGTGTGGCAAC
AACCGCACCATTGAACCCGAGGCGCTGCGGCGGGGCAACATGAGCTCCCT
GGGCTTCACGAGCAAGGAGCAGCGGAACCTGGGCCTCCTCGTGCACCTCA
TGACCAGCAACCCCAAAATCCTGTACGCGCCTGCGGGCTCTGAGGTCGAC
CGCGTCATCCTCAAGGCCAACGAGACTTTTGCTTTTGTGGGCAACGTGAC
TCACTATGCCCAGGTCTGGCTCAACATCTCGGCGGAGATCCGCAGCTTCC
TGGAGCAGGGCAGGCTGCAGCAACACCTGCGCTGGCTGCAGCAGTATGTA
GCAGAGCTGCGGCTGCACCCCGAGGCACTGAACCTGTCACTGGATGAGCT
GCCGCCGGCCCTGAGACAGGACAACTTCTCGCTGCCCAGTGGCATGGCCC
TCCTGCAGCAGCTGGATACCATTGACAACGCGGCCTGCGGCTGGATCCAG
TTCATGTCCAAGGTGAGCGTGGACATCTTCAAGGGCTTCCCCGACGAGGA
GAGCATTGTCAACTACACCCTCAACCAGGCCTACCAGGACAACGTCACTG
TTTTTGCCAGTGTGATCTTCCAGACCCGGAAGGACGGCTCGCTCCCGCCT
CACGTGCACTACAAGATCCGCCAGAACTCCAGCTTCACCGAGAAAACCAA
CGAGATCCGCCGCGCCTACTGGCGGCCTGGGCCCAATACTGGCGGCCGCT
TCTACTTCCTCTACGGCTTCGTCTGGATCCAGGACATGATGGAGCGCGCC
ATCATCGACACTTTTGTGGGGCACGATGTGGTGGAGCCAGGCAGCTACGT
GCAGATGTTCCCCTACCCCTGCTACACACGCGATGACTTCCTGTTTGTCA
TTGAGCACATGATGCCGCTGTGCATGGTGATCTCCTGGGTCTACTCCGTG
GCCATGACCATCCAGCACATCGTGGCGGAGAAGGAGCACCGGCTCAAGGA
GGTGATGAAGACCATGGGCCTGAACAACGCGGTGCACTGGGTGGCCTGGT
TCATCACCGGCTTTGTGCAGCTGTCCATCTCCGTGACAGCACTCACCGCC
ATCCTGAAGTACGGCCAGGTGCTTATGCACAGCCACGTGGTCATCATCTG
GCTCTTCCTGGCAGTCTACGCGGTGGCCACCATCATGTTCTGCTTCCTGG
TGTCTGTGCTGTACTCCAAGGCCAAGCTGGCCTCGGCCTGCGGTGGCATC
ATCTACTTCCTGAGCTACGTGCCCTACATGTACGTGGCGATCCGAGAGGA
GGTGGCGCATGATAAGATCACGGCCTTCGAGAAGTGCATCGCGTCCCTCA
TGTCCACGACGGCCTTTGGTCTGGGCTCTAAGTACTTCGCGCTGTATGAG
GTGGCCGGCGTGGGCATCCAGTGGCACACCTTCAGCCAGTCCCCGGTGGA
GGGGGACGACTTCAACTTGCTCCTGGCTGTCACCATGCTGATGGTGGACG
CCGTGGTCTATGGCATCCTCACGTGGTACATTGAGGCTGTGCACCCAGGC
ATGTACGGGCTGCCCCGGCCCTGGTACTTCCCACTGCAGAAGTCCTACTG
GCTGGGCAGTGGGCGGACAGAAGCCTGGGAGTGGAGCTGGCCGTGGGCAC
GCACCCCCCGCCTCAGTGTCATGGAGGAGGACCAGGCCTGTGCCATGGAG
AGCCGGCGCTTTGAGGAGACCCGTGGCATGGAGGAGGAGCCCACCCACCT
GCCTCTGGTTGTCTGCGTGGACAAACTCACCAAGGTCTACAAGGACGACA
AGAAGCTGGCCCTGAACAAGCTGAGCCTGAACCTCTACGAGAACCAGGTG
GTCTCCTTCTTGGGCCACAACGGGGCGGGCAAGACCACCACCATGTCCAT
CCTGACCGGCCTGTTCCCTCCAACGTCGGGTTCCGCCACCATCTACGGGC
ACGACATCCGCACGGAGATGGATGAGATCCGCAAGAACCTGGGCATGTGC
CCGCAGCACAATGTGCTCTTTGACCGGCTCACGGTGGAGGAACACCTCTG
GTTCTACTCACGGCTCAAGAGCATGGCTCAGGAGGAGATCCGCAGAGAGA
TGGACAAGATGATCGAGGACCTGGAGCTCTCCAACAAACGGCACTCACTG
GTGCAGACATTGTCGGGTGGCATGAAGCGCAAGCTGTCCGTGGCCATCGC
CTTCGTGGGCGGCTCTCGCGCCATCATCCTGGACGAGCCCACGGCGGGCG
TGGACCCCTACGCGCGCCGCGCCATCTGGGACCTCATCCTGAAGTACAAG
CCAGGCCGCACCATCCTTCTGTCCACCCACCACATGGATGAGGCTGACCT
GCTTGGGGACCGCATTGCCATCATCTCCCATGGGAAGCTCAAGTGCTGCG
GCTCCCCGCTCTTCCTCAAGGGCACCTATGGCGACGGGTACCGCCTCACG
CTGGTCAAGCGGCCCGCCGAGCCGGGGGGCCCCCAAGAGCCAGGGCTGGC
ATCCAGCCCCCCAGGTCGGGCCCCGCTGAGCAGCTGCTCCGAGCTCCAGG
TGTCCCAGTTCATCCGCAAGCATGTGGCCTCCTGCCTGCTGGTCTCAGAC
ACAAGCACGGAGCTCTCCTACATCCTGCCCAGCGAGGCCGCCAAGAAGGG
GGCTTTCGAGCGCCTCTTCCAGCACCTGGAGCGCAGCCTGGATGCACTGC
ACCTCAGCAGCTTCGGGCTGATGGACACGACCCTGGAGGAAGTGTTCCTC
AAGGTGTCGGAGGAGGATCAGTCGCTGGAGAACAGTGAGGCCGATGTGAA
GGAGTCCAGGAAGGATGTGCTCCCTGGGGCGGAGGGCCCGGCGTCTGGGG
AGGGTCACGCTGGCAATCTGGCCCGGTGCTCGGAGCTGACCCAGTCGCAG
GCATCGCTGCAGTCGGCGTCATCTGTGGGCTCTGCCCGTGGCGACGAGGG
AGCTGGCTACACCGACGTCTATGGCGACTACCGCCCCCTCTTTGATAACC
CACAGGACCCAGACAATGTCAGCCTGCAAGAGGTGGAGGCAGAGGCCCTG
TCGAGGGTCGGCCAGGGCAGCCGCAAGCTGGACGGCGGGTGGCTGAAGGT
GCGCCAGTTCCACGGGCTGCTGGTCAAACGCTTCCACTGCGCCCGCCGCA
ACTCCAAGGCACTCTTCTCCCAGATCTTGCTGCCAGCCTTCTTCGTCTGC
GTGGCCATGACCGTGGCCCTGTCCGTCCCGGAGATTGGTGATCTGCCCCC
GCTGGTCCTGTCACCTTCCCAGTACCACAACTACACCCAGCCCCGTGGCA
ATTTCATCCCCTACGCCAACGAGGAGCGCCGCGAGTACCGGCTGCGGCTA
TCGCCCGACGCCAGCCCCCAGCAGCTCGTGAGCACGTTCCGGCTGCCGTC
GGGGGTGGGTGCCACCTGCGTGCTCAAGTCTCCCGCCAACGGCTCGCTGG
GGCCCACGTTGAACCTGAGCAGCGGGGAGTCGCGCCTGCTGGCGGCTCGG
TTCTTCGACAGCATGTGTCTGGAGTCCTTCACACAGGGGCTGCCACTGTC
CAATTTCGTGCCACCCCCACCCTCGCCCGCCCCATCTGACTCGCCAGCGT
CCCCGGATGAGGACCTGCAGGCCTGGAACGTCTCCCTGCCGCCCACCGCT
GGGCCAGAAATGTGGACGTCGGCACCCTCCCTGCCGCGCCTGGTACGGGA
GCCCGTCCGCTGCACCTGCTCTGCGCAGGGCACCGGCTTCTCCTGCCCCA
GCAGTGTGGGCGGGCACCCGCCCCAGATGCGGGTGGTCACAGGCGACATC
CTGACCGACATCACCGGCCACAATGTCTCTGAGTACCTGCTCTTCACCTC
CGACCGCTTCCGACTGCACCGGTATGGGGCCATCACCTTTGGAAACGTCC
TGAAGTCCATCCCAGCCTCATTTGGCACCAGGGCCCCACCCATGGTGCGG
AAGATCGCGGTGCGCAGGGCTGCCCAGGTTTTCTACAACAACAAGGGCTA
TCACAGCATGCCCACCTACCTCAACAGCCTCAACAACGCCATCCTGCGTG
CCAACCTGCCCAAGAGCAAGGGCAACCCGGCGGCTTACGGCATCACCGTC
ACCAACCACCCCATGAATAAGACCAGCGCCAGCCTCTCCCTGGATTACCT
GCTGCAGGGCACGGATGTCGTCATCGCCATCTTCATCATCGTGGCCATGT
CCTTCGTGCCGGCCAGCTTCGTTGTCTTCCTCGTGGCCGAGAAGTCCACC
AAGGCCAAGCACCTGCAGTTTGTCAGCGGCTGCAACCCCATCATCTACTG
GCTGGCGAACTACGTGTGGGACATGCTCAACTACCTGGTCCCCGCTACCT
GCTGTGTCATCATCCTGTTTGTGTTCGACCTGCCGGCCTACACGTCGCCC
ACCAACTTCCCTGCCGTCCTCTCCCTCTTCCTGCTCTATGGGTGGTCCAT
CACGCCCATCATGTACCCGGCCTCCTTCTGGTTCGAGGTCCCCAGCTCCG
CCTACGTGTTCCTCATTGTCATCAATCTCTTCATCGGCATCACCGCCACC
GTGGCCACCTTCCTGCTACAGCTCTTCGAGCACGACAAGGACCTGAAGGT
TGTCAACAGTTACCTGAAAAGCTGCTTCCTCATTTTCCCCAACTACAACC
TGGGCCACGGGCTCATGGAGATGGCCTACAACGAGTACATCAACGAGTAC
TACGCCAAGATTGGCCAGTTTGACAAGATGAAGTCCCCGTTCGAGTGGGA
CATTGTCACCCGCGGACTGGTGGCCATGGCGGTTGAGGGCGTCGTGGGCT
TCCTCCTGACCATCATGTGCCAGTACAACTTCCTGCGGCGGCCACAGCGC
ATGCCTGTGTCTACCAAGCCTGTGGAGGATGATGTGGACGTGGCCAGTGA
GCGGCAGCGAGTGCTCCGGGGAGACGCCGACAATGACATGGTCAAGATTG
AGAACCTGACCAAGGTCTACAAGTCCCGGAAGATTGGCCGTATCCTGGCC
GTTGACCGCCTGTGCCTGGGTGTGCGTCCTGGCGAGTGCTTCGGGCTCCT
GGGCGTCAACGGTGCGGGCAAGACCAGCACCTTCAAGATGCTGACCGGCG
ACGAGAGCACGACGGGGGGCGAGGCCTTCGTCAATGGACACAGCGTGCTG
AAGGAGCTGCTCCAGGTGCAGCAGAGCCTCGGCTACTGCCCGCAGTGTGA
CGCGCTGTTCGACGAGCTCACGGCCCGGGAGCACCTGCAGCTGTACACGC
GGCTGCGTGGGATCTCCTGGAAGGACGAGGCCCGGGTGGTGAAGTGGGCT
CTGGAGAAGCTGGAGCTGACCAAGTACGCAGACAAGCCGGCTGGCACCTA
CAGCGGCGGCAACAAGCGGAAGCTCTCCACGGCCATCGCCCTCATTGGGT
ACCCAGCCTTCATCTTCCTGGACGAGCCCACCACAGGCATGGACCCCAAG
GCCCGGCGCTTCCTCTGGAACCTCATCCTTGACCTCATCAAGACAGGGCG
TTCAGTGGTGCTGACATCACACAGCATGGAGGAGTGCGAGGCGCTGTGCA
CGCGGCTGGCCATCATGGTGAACGGTCGCCTGCGGTGCCTGGGCAGCATC
CAGCACCTGAAGAACCGGTTTGGAGATGGCTACATGATCACGGTGCGGAC
CAAGAGCAGCCAGAGTGTGAAGGACGTGGTGCGGTTCTTCAACCGCAACT
TCCCGGAAGCCATGCTCAAGGAGCGGCACCACACAAAGGTGCAGTACCAG
CTCAAGTCGGAGCACATCTCGCTGGCCCAGGTGTTCAGCAAGATGGAGCA
GGTGTCTGGCGTGCTGGGCATCGAGGACTACTCGGTCAGCCAGACCACAC
TGGACAATGTGTTCGTGAACTTTGCCAAGAAGCAGAGTGACAACCTGGAG
CAGCAGGAGACGGAGCCGCCATCCGCACTGCAGTCCCCTCTCGGCTGCTT
GCTCAGCCTGCTCCGGCCCCGGTCTGCCCCCACGGAGCTCCGGGCACTTG
TGGCAGACGAGCCCGAGGACCTGGACACGGAGGACGAGGGCCTCATCAGC
TTCGAGGAGGAGCGGGCCCAGCTGTCCTTCAACACGGACACGCTCTGCTA
G
MGRKTSRVQQGPPRSPACSAHGERSWGLEFPPFRWLLGIAGRTHLAALPP
FQWVLAFEIFIPLVLFFILLGLRQKKPTISVKEVSFYTAAPLTSAGILPV
MQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPSLGSE
LEALRQHLEALSAGPGTSGSHLDRSTVSSFSLDSVARNPQELWRFLTQNL
SLPNSTAQALLAARVDPPEVYHLLFGPSSALDSQSGLHKGQEPWSRLGGN
PLFRMEELLLAPALLEQLTCTPGSGELGRILTVPESQKGALQGYRDAVCS
GQAAARARRFSGLSAELRNQLDVAKVSQQLGLDAPNGSDSSPQAPPPRRL
QALLGDLLDAQKVLQDVDVLSALALLLPQGACTGRTPGPPASGAGGAANG
TGAGAVMGPNATAEEGAPSAAALATPDTLQGQCSAFVQLWAGLQPILCGN
NRTIEPEALRRGNMSSLGFTSKEQRNLGLLVHLMTSNPKILYAPAGSEVD
RVILKANETFAFVGNVTHYAQVWLNISAEIRSFLEQGRLQQHLRWLQQYV
AELRLHPEALNLSLDELPPALRQDNFSLPSGMALLQQLDTIDNAACGWIQ
FMSKVSVDIFKGFPDEESIVNYTLNQAYQDNVTVFASVIFQTRKDGSLPP
HVHYKIRQNSSFTEKTNEIRRAYWRPGPNTGGRFYFLYGFVWIQDMMERA
IIDTFVGHDVVEPGSYVQMFPYPCYTRDDFLFVIEHMMPLCMVISWVYSV
AMTIQHIVAEKEHRLKEVMKTMGLNNAVHWVAWFITGFVQLSISVTALTA
ILKYGQVLMHSHVVIIWLFLAVYAVATIMFCFLVSVLYSKAKLASACGGI
IYFLSYVPYMYVAIREEVAHDKITAFEKCIASLMSTTAFGLGSKYFALYE
VAGVGIQWHTFSQSPVEGDDFNLLLAVTMLMVDAVVYGILTWYIEAVHPG
MYGLPRPWYFPLQKSYWLGSGRTEAWEWSWPWARTPRLSVMEEDQACAME
SRRFEETRGMEEEPTHLPLVVCVDKLTKVYKDDKKLALNKLSLNLYENQV
VSFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMC
PQHNVLFDRLTVEEHLWFYSRLKSMAQEEIRREMDKMIEDLELSNKRHSL
VQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLILKYK
PGRTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGTYGDGYRLT
LVKRPAEPGGPQEPGLASSPPGRAPLSSCSELQVSQFIRKHVASCLLVSD
TSTELSYILPSEAAKKGAFERLFQHLERSLDALHLSSFGLMDTTLEEVFL
KVSEEDQSLENSEADVKESRKDVLPGAEGPASGEGHAGNLARCSELTQSQ
ASLQSASSVGSARGDEGAGYTDVYGDYRPLFDNPQDPDNVSLQEVEAEAL
SRVGQGSRKLDGGWLKVRQFHGLLVKRFHCARRNSKALFSQILLPAFFVC
VAMTVALSVPEIGDLPPLVLSPSQYHNYTQPRGNFIPYANEERREYRLRL
SPDASPQQLVSTFRLPSGVGATCVLKSPANGSLGPTLNLSSGESRLLAAR
FFDSMCLESFTQGLPLSNFVPPPPSPAPSDSPASPDEDLQAWNVSLPPTA
GPEMWTSAPSLPRLVREPVRCTCSAQGTGFSCPSSVGGHPPQMRVVTGDI
LTDITGHNVSEYLLFTSDRFRLHRYGAITFGNVLKSIPASFGTRAPPMVR
KIAVRRAAQVFYNNKGYHSMPTYLNSLNNAILRANLPKSKGNPAAYGITV
TNHPMNKTSASLSLDYLLQGTDVVIAIFIIVAMSFVPASFVVFLVAEKST
KAKHLQFVSGCNPIIYWLANYVWDMLNYLVPATCCVIILFVFDLPAYTSP
TNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITAT
VATFLLQLFEHDKDLKVVNSYLKSCFLIFPNYNLGHGLMEMAYNEYINEY
YAKIGQFDKMKSPFEWDIVTRGLVAMAVEGVVGFLLTIMCQYNFLRRPQR
MPVSTKPVEDDVDVASERQRVLRGDADNDMVKIENLTKVYKSRKIGRILA
VDRLCLGVRPGECFGLLGVNGAGKTSTFKMLTGDESTTGGEAFVNGHSVL
KELLQVQQSLGYCPQCDALFDELTAREHLQLYTRLRGISWKDEARVVKWA
LEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPK
ARRFLWNLILDLIKTGRSVVLTSHSMEECEALCTRLAIMVNGRLRCLGSI
QHLKNRFGDGYMITVRTKSSQSVKDVVRFFNRNFPEAMLKERHHTKVQYQ
LKSEHISLAQVFSKMEQVSGVLGIEDYSVSQTTLDNVFVNFAKKQSDNLE
QQETEPPSALQSPLGCLLSLLRPRSAPTELRALVADEPEDLDTEDEGLIS
FEEERAQLSFNTDTLC*

Index