Stock Number Hs0612

Human Gene: PUM2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PUM2 pumilio RNA binding family member 2 HGNC:14958 2p24.1 pum 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection IOH38629 pGW-HA.attB NM_015317.1 Reference Closed

Stocks

Docking Site DGRC BDSC FBti
VK37NO84740

Sequences

DNA sequence (3195 bp) Protein sequence (1065 aa)
ATGAATCATGATTTTCAAGCTCTTGCATTAGAATCTCGGGGAATGGGAGA
GCTTTTGCCTACCAAAAAGTTTTGGGAACCTGATGATTCAACAAAAGATG
GACAAAAAGGCATATTTCTTGGGGATGATGAATGGAGAGAGACTGCATGG
GGAGCTTCTCACCATTCAATGTCCCAGCCTATTATGGTACAGAGAAGATC
TGGACAGGGTTTTCATGGAAACAGTGAAGTAAATGCAATACTGTCTCCGC
GATCAGAAAGTGGAGGCCTTGGTGTGAGCATGGTAGAATATGTATTAAGT
TCTTCTCCTGCTGATAAATTGGATTCTCGATTTAGGAAGGGAAATTTTGG
CACTAGAGATGCTGAAACAGATGGACCTGAGAAAGGAGATCAAAAAGGCA
AGGCTTCTCCATTTGAGGAGGACCAAAACAGAGATCTTAAACAAGGAGAT
GATGATGATTCTAAAATAAATGGCAGAGGTTTGCCAAATGGAATGGATGC
CGATTGCAAAGATTTTAATCGTACTCCTGGAAGTCGTCAAGCCTCTCCAA
CTGAAGTAGTTGAGCGCTTGGGCCCCAATACTAATCCCTCAGAAGGACTG
GGGCCTCTTCCTAATCCTACAGCTAATAAACCACTTGTTGAAGAATTTTC
AAATCCTGAAACTCAGAATCTGGATGCCATGGAACAAGTTGGTCTGGAAT
CCTTACAGTTTGACTATCCTGGTAATCAGGTACCAATGGACTCTTCAGGA
GCTACTGTAGGCCTTTTTGACTACAATTCCCAGCAGCAGCTCTTTCAGAG
GACTAATGCACTAACAGTTCAACAGTTAACTGCAGCTCAACAGCAGCAAT
ATGCATTAGCAGCAGCTCAGCAGCCACATATAGCTGGTGTATTCTCAGCA
GGCCTTGCTCCAGCTGCATTTGTGCCAAATCCATACATTATTAGTGCTGC
TCCTCCAGGGACCGATCCGTATACTGCAGCAGGATTGGCTGCAGCAGCTA
CATTAGCAGGTCCAGCAGTGGTTCCACCTCAGTATTACGGCGTTCCATGG
GGGGTGTATCCAGCCAACTTATTTCAGCAGCAAGCTGCAGCTGCGGCAAA
TAACACAGCCAGTCAGCAAGCAGCATCACAAGCTCAGCCTGGACAGCAAC
AGGTTCTCCGTGCTGGAGCAGGTCAGCGTCCTCTTACTCCCAATCAGGGT
CAGCAAGGGCAGCAAGCAGAATCACTTGCGGCAGCTGCAGCAGCAAATCC
AACATTGGCTTTTGGTCAGGGTCTTGCTACTGGCATGCCAGGCTATCAAG
TACTAGCTCCAACTGCCTATTATGATCAGACTGGTGCCTTAGTGGTTGGC
CCTGGAGCAAGGACTGGCCTTGGAGCTCCAGTTCGGTTAATGGCTCCAAC
ACCTGTTTTAATTAGTTCAGCAGCAGCACAAGCTGCAGCAGCAGCAGCAG
CTGGAGGAACTGCAAGTAGCCTTACAGGCAGCACAAATGGTCTGTTTCGG
CCAATTGGCACTCAGCCACCACAGCAGCAGCAACAGCAGCCAAGCACTAA
TCTGCAATCTAATTCATTTTATGGAAGCAGTTCTTTGACTAATAGCTCCC
AGAGTAGTTCTTTATTTTCTCATGGACCTGGTCAACCTGGAAGTACATCT
CTTGGCTTTGGAAGTGGTAACTCTTTGGGTGCTGCTATAGGCTCAGCCCT
CAGTGGATTTGGTTCATCAGTTGGCAGTTCTGCAAGTAGTAGTGCCACAA
GGAGAGAGTCTCTATCTACTAGCTCTGACTTGTACAAAAGATCTAGTAGC
AGCCTAGCACCCATAGGGCAACCATTTTACAATAGTCTGGGATTTTCCTC
CTCTCCAAGTCCAATAGGCATGCCTCTGCCAAGCCAAACTCCAGGACATT
CACTTACGCCACCGCCATCACTTTCATCACATGGATCCTCATCCAGTTTG
CATTTAGGAGGACTGACAAATGGTAGTGGTCGATATATCTCTGCAGCACC
TGGAGCAGAAGCAAAATATCGAAGTGCTTCAAGCACTTCCAGTCTATTTA
GCTCCAGCAGCCAGCTCTTTCCTCCTTCCCGGCTTCGGTATAATAGGTCT
GATATTATGCCTTCTGGCCGCAGTAGATTATTGGAAGATTTCAGAAACAA
CCGCTTCCCAAACCTTCAGCTTAGAGACTTGATTGGACATATAGTTGAGT
TTTCTCAAGACCAGCATGGTTCTAGATTCATACAGCAAAAACTAGAGAGA
GCTACTCCAGCTGAGCGACAGATGGTATTTAATGAAATTCTGCAAGCAGC
CTATCAATTAATGACTGATGTTTTTGGCAACTATGTTATACAGAAGTTTT
TTGAGTTTGGGAGTCTGGATCAAAAATTAGCCCTGGCTACTCGTATTCGT
GGTCATGTTCTACCCTTAGCCTTGCAGATGTATGGCTGCCGCGTTATTCA
GAAAGCATTAGAATCTATTTCTTCTGACCAGCAGAGTGAAATGGTAAAGG
AGCTGGATGGTCATGTGCTCAAATGTGTGAAAGATCAGAATGGAAACCAT
GTTGTACAAAAATGTATCGAATGTGTTCAGCCACAGTCACTACAGTTCAT
CATTGATGCTTTCAAGGGACAAGTATTTGTGCTTTCAACTCATCCTTATG
GCTGCAGAGTAATTCAGCGCATCCTAGAGCATTGCACTGCAGAACAGACC
TTACCTATCTTAGAAGAACTCCACCAACATACAGAGCAGTTGGTACAGGA
TCAGTATGGCAATTATGTTATTCAGCATGTACTGGAACACGGTCGACCTG
AAGACAAGAGCAAAATTGTTTCCGAAATCAGGGGAAAGGTTTTAGCCCTG
AGTCAACACAAATTTGCCAGCAATGTAGTAGAAAAGTGTGTTACTCATGC
CTCCCGTGCTGAGAGAGCTTTACTGATTGACGAGGTTTGCTGCCAGAATG
ATGGTCCTCACAGTGCCTTATACACCATGATGAAGGACCAGTATGCCAAT
TACGTGGTTCAAAAGATGATTGATATGGCTGAACCTGCTCAGAGAAAGAT
AATCATGCACAAGATTCGACCTCACATTACTACTTTGCGCAAATACACAT
ACGGGAAGCATATACTGGCCAAGTTGGAAAAGTATTATTTGAAGAATAGC
CCGGACCTAGGACCTATTGGAGGACCACCAAATGGAATGCTGTAA
MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAW
GASHHSMSQPIMVQRRSGQGFHGNSEVNAILSPRSESGGLGVSMVEYVLS
SSPADKLDSRFRKGNFGTRDAETDGPEKGDQKGKASPFEEDQNRDLKQGD
DDDSKINGRGLPNGMDADCKDFNRTPGSRQASPTEVVERLGPNTNPSEGL
GPLPNPTANKPLVEEFSNPETQNLDAMEQVGLESLQFDYPGNQVPMDSSG
ATVGLFDYNSQQQLFQRTNALTVQQLTAAQQQQYALAAAQQPHIAGVFSA
GLAPAAFVPNPYIISAAPPGTDPYTAAGLAAAATLAGPAVVPPQYYGVPW
GVYPANLFQQQAAAAANNTASQQAASQAQPGQQQVLRAGAGQRPLTPNQG
QQGQQAESLAAAAAANPTLAFGQGLATGMPGYQVLAPTAYYDQTGALVVG
PGARTGLGAPVRLMAPTPVLISSAAAQAAAAAAAGGTASSLTGSTNGLFR
PIGTQPPQQQQQQPSTNLQSNSFYGSSSLTNSSQSSSLFSHGPGQPGSTS
LGFGSGNSLGAAIGSALSGFGSSVGSSASSSATRRESLSTSSDLYKRSSS
SLAPIGQPFYNSLGFSSSPSPIGMPLPSQTPGHSLTPPPSLSSHGSSSSL
HLGGLTNGSGRYISAAPGAEAKYRSASSTSSLFSSSSQLFPPSRLRYNRS
DIMPSGRSRLLEDFRNNRFPNLQLRDLIGHIVEFSQDQHGSRFIQQKLER
ATPAERQMVFNEILQAAYQLMTDVFGNYVIQKFFEFGSLDQKLALATRIR
GHVLPLALQMYGCRVIQKALESISSDQQSEMVKELDGHVLKCVKDQNGNH
VVQKCIECVQPQSLQFIIDAFKGQVFVLSTHPYGCRVIQRILEHCTAEQT
LPILEELHQHTEQLVQDQYGNYVIQHVLEHGRPEDKSKIVSEIRGKVLAL
SQHKFASNVVEKCVTHASRAERALLIDEVCCQNDGPHSALYTMMKDQYAN
YVVQKMIDMAEPAQRKIIMHKIRPHITTLRKYTYGKHILAKLEKYYLKNS
PDLGPIGGPPNGML*

Index