Stock Number Hs0610

Human Gene: PUM1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PUM1 pumilio RNA binding family member 1 HGNC:14957 1p35.2 pum 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
pPMW-attB Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO84739 FBti0207880

Sequences

DNA sequence (3885 bp) Protein sequence (1295 aa)
ATGGAGCAAAAGCTCATTTCTGAAGAGGACTTGAATGAAATGGAGCAAAA
GCTCATTTCTGAAGAGGACTTGAATGAAATGGAGCAAAAGCTCATTTCTG
AAGAGGACTTGAATGAAATGGAGCAAAAGCTCATTTCTGAAGAGGACTTG
AATGAAATGGAGCAAAAGCTCATTTCTGAAGAGGACTTGAATGAAATGGA
GAGCTTGGGCGACCTCACCATGGAGCAAAAGCTCATTTCTGAAGAGGACT
TGAATCACCGGTATACAAGTTTGTACAAAAAAGCAGGCTTCACCATGAGC
GTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAG
CCCCCACCTGAAACATCACCCTCAAGAACCAGCTAATCCCAACATGCCTG
TTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCA
AATCAGGCTCTTGCAGCTGGGACTCACTCCAGCCCTGTCCCAGGATCTAT
AGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTC
AGAGGCAGCATGGTGAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGC
TATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGA
ACATCAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTG
CTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAAAAGTTT
TGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGG
TGATCAATGGCGAGACAGTGCCTGGGGAACATCAGATCATTCAGTTTCCC
AGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGT
GAGGTCAATTCTGTACTGTCCCCACGATCGGAGAGTGGGGGACTAGGCGT
TAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAA
GAAAAGGAGGATTTGGCCCAAGGGATGCAGACAGTGATGAAAACGACAAA
GGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTT
GAAGGAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGA
ATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGTAATTGC
CAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTC
TGAGGGCTTAGCCCAGCTGACCAGCACCAATGGTGCCAAGCCTGTGGAGG
ATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACAT
GTGGGCATGGAGCCTCTTCAGTTTGATTATTCAGGCACGCAGGTACCTGT
GGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAAC
AGCTGTTCCAAAGACCTAATGCGCTTGCTGTCCAGCAGTTGACAGCTGCT
CAGCAGCAGCAGTATGCACTGGCAGCTGCTCATCAGCCGCACATCGGTTT
AGCTCCCGCTGCGTTTGTCCCCAATCCATACATCATCAGCGCTGCTCCCC
CAGGGACGGACCCCTACACAGCTGGATTGGCTGCAGCAGCGACACTAGGC
CCAGCTGTGGTCCCTCACCAGTATTATGGAGTTACTCCCTGGGGAGTCTA
CCCTGCCAGTCTTTTCCAGCAGCAAGCTGCCGCTGCCGCTGCAGCAACTA
ATTCAGCTAATCAACAGACCACCCCACAGGCTCAGCAAGGACAGCAGCAG
GTTCTCCGTGGAGGAGCCAGCCAACGTCCTTTGACCCCAAACCAGAACCA
GCAGGGACAGCAAACGGATCCCCTTGTGGCAGCTGCAGCAGTGAATTCTG
CCCTTGCATTTGGACAAGGTCTGGCAGCAGGCATGCCAGGTTATCCGGTG
TTGGCTCCTGCTGCTTACTATGACCAAACTGGTGCCCTTGTAGTGAATGC
AGGCGCGAGAAATGGTCTTGGAGCTCCTGTTCGACTTGTAGCTCCTGCCC
CAGTCATCATTAGTTCCTCAGCTGCACAAGCAGCTGTTGCAGCAGCCGCA
GCTTCAGCAAATGGAGCAGCTGGTGGTCTTGCTGGAACAACAAATGGACC
ATTTCGCCCTTTAGGAACACAGCAGCCTCAGCCCCAGCCCCAGCAGCAGC
CCAATAACAACCTGGCATCCAGTTCTTTCTACGGCAACAACTCTCTGAAC
AGCAATTCACAGAGCAGCTCCCTCTTCTCCCAGGGCTCTGCCCAGCCTGC
CAACACATCCTTGGGATTCGGAAGTAGCAGTTCTCTCGGCGCCACCCTGG
GATCCGCCCTTGGAGGGTTTGGAACAGCAGTTGCAAACTCCAACACTGGC
AGTGGCTCCCGCCGTGACTCCCTGACTGGCAGCAGTGACCTTTATAAGAG
GACATCGAGCAGCTTGACCCCCATTGGACACAGTTTTTATAACGGCCTTA
GCTTTTCCTCCTCTCCTGGACCCGTGGGCATGCCTCTCCCTAGTCAGGGA
CCAGGACATTCACAGACACCACCTCCTTCCCTCTCTTCACATGGATCCTC
TTCAAGCTTAAACCTGGGAGGACTCACGAACGGCAGTGGAAGATACATCT
CTGCTGCTCCAGGCGCTGAAGCCAAGTACCGCAGTGCAAGCAGCGCCTCC
AGCCTCTTCAGCCCGAGCAGCACTCTTTTCTCTTCCTCTCGTTTGCGATA
TGGAATGTCTGATGTCATGCCTTCTGGCAGGAGCAGGCTTTTGGAAGATT
TTCGAAACAACCGGTACCCCAATTTACAACTGCGGGAGATTGCTGGACAT
ATAATGGAATTTTCCCAAGACCAGCATGGGTCCAGATTCATTCAGCTGAA
ACTGGAGCGTGCCACACCAGCTGAGCGCCAGCTTGTCTTCAATGAAATCC
TCCAGGCTGCCTACCAACTCATGGTGGATGTGTTTGGTAATTACGTCATT
CAGAAGTTCTTTGAATTTGGCAGTCTTGAACAGAAGCTGGCTTTGGCAGA
ACGGATTCGAGGCCACGTCCTGTCATTGGCACTACAGATGTATGGCTGCC
GTGTTATCCAGAAAGCTCTTGAGTTTATTCCTTCAGACCAGCAGGTAATT
AATGAGATGGTTCGGGAACTAGATGGCCATGTCTTGAAGTGTGTGAAAGA
TCAGAATGGCAATCACGTGGTTCAGAAATGCATTGAATGTGTACAGCCCC
AGTCTTTGCAATTTATCATCGATGCGTTTAAGGGACAGGTATTTGCCTTA
TCCACACATCCTTATGGCTGCCGAGTGATTCAGAGAATCCTGGAGCACTG
TCTCCCTGACCAGACACTCCCTATTTTAGAGGAGCTTCACCAGCACACAG
AGCAGCTTGTACAGGATCAATATGGAAATTATGTAATCCAACATGTACTG
GAGCACGGTCGTCCTGAGGATAAAAGCAAAATTGTAGCAGAAATCCGAGG
CAATGTACTTGTATTGAGTCAGCACAAATTTGCAAGCAATGTTGTGGAGA
AGTGTGTTACTCACGCCTCACGTACGGAGCGCGCTGTGCTCATCGATGAG
GTGTGCACCATGAACGACGGTCCCCACAGTGCCTTATACACCATGATGAA
GGACCAGTATGCCAACTACGTGGTCCAGAAGATGATTGACGTGGCGGAGC
CAGGCCAGCGGAAGATCGTCATGCATAAGATCCGGCCCCACATCGCAACT
CTTCGTAAGTACACCTATGGCAAGCACATTCTGGCCAAGCTGGAGAAGTA
CTACATGAAGAACGGTGTTGACTTAGGGCCCATCTGTGGCCCCCCTAATG
GTATCATCACCCAGCTTTCTTGTACAAAGTGGTGA
MEQKLISEEDLNEMEQKLISEEDLNEMEQKLISEEDLNEMEQKLISEEDL
NEMEQKLISEEDLNEMESLGDLTMEQKLISEEDLNHRYTSLYKKAGFTMS
VACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAA
NQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGG
YNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKF
WETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNS
EVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDK
GEKKNKGTFDGDKLGDLKEEGDVMDKTNGLPVQNGIDADVKDFSRTPGNC
QNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEH
VGMEPLQFDYSGTQVPVDSAAATVGLFDYNSQQQLFQRPNALAVQQLTAA
QQQQYALAAAHQPHIGLAPAAFVPNPYIISAAPPGTDPYTAGLAAAATLG
PAVVPHQYYGVTPWGVYPASLFQQQAAAAAAATNSANQQTTPQAQQGQQQ
VLRGGASQRPLTPNQNQQGQQTDPLVAAAAVNSALAFGQGLAAGMPGYPV
LAPAAYYDQTGALVVNAGARNGLGAPVRLVAPAPVIISSSAAQAAVAAAA
ASANGAAGGLAGTTNGPFRPLGTQQPQPQPQQQPNNNLASSSFYGNNSLN
SNSQSSSLFSQGSAQPANTSLGFGSSSSLGATLGSALGGFGTAVANSNTG
SGSRRDSLTGSSDLYKRTSSSLTPIGHSFYNGLSFSSSPGPVGMPLPSQG
PGHSQTPPPSLSSHGSSSSLNLGGLTNGSGRYISAAPGAEAKYRSASSAS
SLFSPSSTLFSSSRLRYGMSDVMPSGRSRLLEDFRNNRYPNLQLREIAGH
IMEFSQDQHGSRFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNYVI
QKFFEFGSLEQKLALAERIRGHVLSLALQMYGCRVIQKALEFIPSDQQVI
NEMVRELDGHVLKCVKDQNGNHVVQKCIECVQPQSLQFIIDAFKGQVFAL
STHPYGCRVIQRILEHCLPDQTLPILEELHQHTEQLVQDQYGNYVIQHVL
EHGRPEDKSKIVAEIRGNVLVLSQHKFASNVVEKCVTHASRTERAVLIDE
VCTMNDGPHSALYTMMKDQYANYVVQKMIDVAEPGQRKIVMHKIRPHIAT
LRKYTYGKHILAKLEKYYMKNGVDLGPICGPPNGIITQLSCTKW*

Index