Stock Number Hs0608

Human Gene: PUM1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PUM1 pumilio RNA binding family member 1 HGNC:14957 1p35.2 pum 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
pGW-HA.attB Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO84738 FBti0207879

Sequences

DNA sequence (3798 bp) Protein sequence (1266 aa)
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTC
TTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCTAATCCCAACA
TGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCA
GCTGCAAATCAGGCTCTTGCAGCTGGGACTCACTCCAGCCCTGTCCCAGG
ATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACT
TCTTTCAGAGGCAGCATGGTGAGCAGCTTGGGGGAGGAGGAAGTGGAGGA
GGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCA
TGCAGAACATCAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAG
CACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAA
AAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATT
CCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCAGATCATTCAG
TTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTG
AACAGTGAGGTCAATTCTGTACTGTCCCCACGATCGGAGAGTGGGGGACT
AGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCT
GTCTAAGAAAAGGAGGATTTGGCCCAAGGGATGCAGACAGTGATGAAAAC
GACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGG
AGATTTGAAGGAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAG
TGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGT
AATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAA
TGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGTGCCAAGCCTG
TGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATG
GAACATGTGGGCATGGAGCCTCTTCAGTTTGATTATTCAGGCACGCAGGT
ACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTC
AACAACAGCTGTTCCAAAGACCTAATGCGCTTGCTGTCCAGCAGTTGACA
GCTGCTCAGCAGCAGCAGTATGCACTGGCAGCTGCTCATCAGCCGCACAT
CGGTTTAGCTCCCGCTGCGTTTGTCCCCAATCCATACATCATCAGCGCTG
CTCCCCCAGGGACGGACCCCTACACAGCTGGATTGGCTGCAGCAGCGACA
CTAGGCCCAGCTGTGGTCCCTCACCAGTATTATGGAGTTACTCCCTGGGG
AGTCTACCCTGCCAGTCTTTTCCAGCAGCAAGCTGCCGCTGCCGCTGCAG
CAACTAATTCAGCTAATCAACAGACCACCCCACAGGCTCAGCAAGGACAG
CAGCAGGTTCTCCGTGGAGGAGCCAGCCAACGTCCTTTGACCCCAAACCA
GAACCAGCAGGGACAGCAAACGGATCCCCTTGTGGCAGCTGCAGCAGTGA
ATTCTGCCCTTGCATTTGGACAAGGTCTGGCAGCAGGCATGCCAGGTTAT
CCGGTGTTGGCTCCTGCTGCTTACTATGACCAAACTGGTGCCCTTGTAGT
GAATGCAGGCGCGAGAAATGGTCTTGGAGCTCCTGTTCGACTTGTAGCTC
CTGCCCCAGTCATCATTAGTTCCTCAGCTGCACAAGCAGCTGTTGCAGCA
GCCGCAGCTTCAGCAAATGGAGCAGCTGGTGGTCTTGCTGGAACAACAAA
TGGACCATTTCGCCCTTTAGGAACACAGCAGCCTCAGCCCCAGCCCCAGC
AGCAGCCCAATAACAACCTGGCATCCAGTTCTTTCTACGGCAACAACTCT
CTGAACAGCAATTCACAGAGCAGCTCCCTCTTCTCCCAGGGCTCTGCCCA
GCCTGCCAACACATCCTTGGGATTCGGAAGTAGCAGTTCTCTCGGCGCCA
CCCTGGGATCCGCCCTTGGAGGGTTTGGAACAGCAGTTGCAAACTCCAAC
ACTGGCAGTGGCTCCCGCCGTGACTCCCTGACTGGCAGCAGTGACCTTTA
TAAGAGGACATCGAGCAGCTTGACCCCCATTGGACACAGTTTTTATAACG
GCCTTAGCTTTTCCTCCTCTCCTGGACCCGTGGGCATGCCTCTCCCTAGT
CAGGGACCAGGACATTCACAGACACCACCTCCTTCCCTCTCTTCACATGG
ATCCTCTTCAAGCTTAAACCTGGGAGGACTCACGAACGGCAGTGGAAGAT
ACATCTCTGCTGCTCCAGGCGCTGAAGCCAAGTACCGCAGTGCAAGCAGC
GCCTCCAGCCTCTTCAGCCCGAGCAGCACTCTTTTCTCTTCCTCTCGTTT
GCGATATGGAATGTCTGATGTCATGCCTTCTGGCAGGAGCAGGCTTTTGG
AAGATTTTCGAAACAACCGGTACCCCAATTTACAACTGCGGGAGATTGCT
GGACATATAATGGAATTTTCCCAAGACCAGCATGGGTCCAGATTCATTCA
GCTGAAACTGGAGCGTGCCACACCAGCTGAGCGCCAGCTTGTCTTCAATG
AAATCCTCCAGGCTGCCTACCAACTCATGGTGGATGTGTTTGGTAATTAC
GTCATTCAGAAGTTCTTTGAATTTGGCAGTCTTGAACAGAAGCTGGCTTT
GGCAGAACGGATTCGAGGCCACGTCCTGTCATTGGCACTACAGATGTATG
GCTGCCGTGTTATCCAGAAAGCTCTTGAGTTTATTCCTTCAGACCAGCAG
GTAATTAATGAGATGGTTCGGGAACTAGATGGCCATGTCTTGAAGTGTGT
GAAAGATCAGAATGGCAATCACGTGGTTCAGAAATGCATTGAATGTGTAC
AGCCCCAGTCTTTGCAATTTATCATCGATGCGTTTAAGGGACAGGTATTT
GCCTTATCCACACATCCTTATGGCTGCCGAGTGATTCAGAGAATCCTGGA
GCACTGTCTCCCTGACCAGACACTCCCTATTTTAGAGGAGCTTCACCAGC
ACACAGAGCAGCTTGTACAGGATCAATATGGAAATTATGTAATCCAACAT
GTACTGGAGCACGGTCGTCCTGAGGATAAAAGCAAAATTGTAGCAGAAAT
CCGAGGCAATGTACTTGTATTGAGTCAGCACAAATTTGCAAGCAATGTTG
TGGAGAAGTGTGTTACTCACGCCTCACGTACGGAGCGCGCTGTGCTCATC
GATGAGGTGTGCACCATGAACGACGGTCCCCACAGTGCCTTATACACCAT
GATGAAGGACCAGTATGCCAACTACGTGGTCCAGAAGATGATTGACGTGG
CGGAGCCAGGCCAGCGGAAGATCGTCATGCATAAGATCCGGCCCCACATC
GCAACTCTTCGTAAGTACACCTATGGCAAGCACATTCTGGCCAAGCTGGA
GAAGTACTACATGAAGAACGGTGTTGACTTAGGGCCCATCTGTGGCCCCC
CTAATGGTATCATCGACCCAGCTTTCTTGTACAAAGTGGTGGTACCTCGA
AGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTC
AGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGT
TAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTC
CCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQP
AANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHGEQLGGGGSGG
GGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGK
KFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHV
NSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDEN
DKGEKKNKGTFDGDKLGDLKEEGDVMDKTNGLPVQNGIDADVKDFSRTPG
NCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPM
EHVGMEPLQFDYSGTQVPVDSAAATVGLFDYNSQQQLFQRPNALAVQQLT
AAQQQQYALAAAHQPHIGLAPAAFVPNPYIISAAPPGTDPYTAGLAAAAT
LGPAVVPHQYYGVTPWGVYPASLFQQQAAAAAAATNSANQQTTPQAQQGQ
QQVLRGGASQRPLTPNQNQQGQQTDPLVAAAAVNSALAFGQGLAAGMPGY
PVLAPAAYYDQTGALVVNAGARNGLGAPVRLVAPAPVIISSSAAQAAVAA
AAASANGAAGGLAGTTNGPFRPLGTQQPQPQPQQQPNNNLASSSFYGNNS
LNSNSQSSSLFSQGSAQPANTSLGFGSSSSLGATLGSALGGFGTAVANSN
TGSGSRRDSLTGSSDLYKRTSSSLTPIGHSFYNGLSFSSSPGPVGMPLPS
QGPGHSQTPPPSLSSHGSSSSLNLGGLTNGSGRYISAAPGAEAKYRSASS
ASSLFSPSSTLFSSSRLRYGMSDVMPSGRSRLLEDFRNNRYPNLQLREIA
GHIMEFSQDQHGSRFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNY
VIQKFFEFGSLEQKLALAERIRGHVLSLALQMYGCRVIQKALEFIPSDQQ
VINEMVRELDGHVLKCVKDQNGNHVVQKCIECVQPQSLQFIIDAFKGQVF
ALSTHPYGCRVIQRILEHCLPDQTLPILEELHQHTEQLVQDQYGNYVIQH
VLEHGRPEDKSKIVAEIRGNVLVLSQHKFASNVVEKCVTHASRTERAVLI
DEVCTMNDGPHSALYTMMKDQYANYVVQKMIDVAEPGQRKIVMHKIRPHI
ATLRKYTYGKHILAKLEKYYMKNGVDLGPICGPPNGIIDPAFLYKVVVPR
SSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDV
PDYAGSYPYDVPDYA*

Index