Stock Number Hs0574

Human Gene: SBK1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SBK1 SH3 Domain Binding Kinase 1 HGNC:17699 16p11.2 meng 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection IOH82249 pUASgHA.attB NM_001024401.2 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166265084736

Sequences

DNA sequence (1461 bp) Protein sequence (487 aa)
ATGAGCGTGGGCTGCCCAGAGCCTGAGCCGCCCCGCTCCCTGACCTGCTG
TGGGCCGGGGACTGCCCCTGGGCCTGGTGCCGGTGTGCCCCTTCTCACTG
AAGACATGCAGGCCCTGACTCTCCGCACACTGGCCGCCAGCGACGTCACC
AAGCACTACGAACTAGTCCGGGAGCTGGGCAAAGGCACCTATGGGAAGGT
TGACCTGGTGGTCTACAAGGGCACAGGCACAAAAATGGCACTGAAGTTTG
TGAACAAGAGCAAAACCAAGCTGAAGAACTTCCTACGGGAGGTGAGCATC
ACCAACAGCCTCTCCTCCAGCCCCTTCATCATCAAGGTCTTTGACGTGGT
CTTTGAGACAGAGGACTGCTACGTCTTTGCCCAGGAGTACGCACCTGCTG
GGGACCTGTTTGACATCATCCCTCCCCAGGTGGGGCTCCCTGAGGACACG
GTGAAGCGCTGTGTGCAGCAGCTGGGCCTGGCGCTGGACTTCATGCACGG
GCGGCAGCTGGTGCACCGCGACATCAAGCCCGAGAACGTGCTGCTGTTCG
ACCGCGAGTGCCGCCGCGTAAAGCTGGCCGACTTCGGCATGACGCGCCGC
GTGGGCTGCCGCGTCAAGCGCGTGAGCGGCACCATCCCTTACACGGCGCC
TGAGGTGTGCCAGGCGGGCCGCGCCGACGGGCTGGCGGTGGACACGGGCG
TGGACGTGTGGGCCTTCGGCGTGCTCATCTTCTGCGTGCTCACCGGCAAC
TTCCCGTGGGAGGCGGCGTCGGGCGCCGACGCCTTCTTCGAGGAGTTCGT
GCGCTGGCAGCGGGGCCGCCTGCCGGGGCTGCCTTCGCAGTGGCGCCGCT
TCACCGAGCCCGCGCTGCGCATGTTCCAGCGCTTACTGGCCCTGGAGCCC
GAGCGCCGCGGCCCAGCCAAGGAGGTGTTCCGCTTCCTCAAGCACGAGCT
CACGTCCGAGCTGCGCCGCCGGCCCTCGCACCGCGCGCGCAAGCCCCCCG
GGGACCGCCCGCCCGCCGCCGGGCCACTGCGCCTCGAGGCGCCTGGGCCG
CTCAAGCGGACGGTGCTGACCGAGAGCGGCAGCGGCTCCCGGCCCGCGCC
CCCCGCCGTCGGGTCGGTGCCCTTGCCCGTGCCGGTGCCGGTGCCAGTGC
CCGTGCCGGTGCCTGTGCCCGAGCCCGGCCTAGCTCCCCAGGGGCCCCCC
GGCCGGACCGACGGCCGCGCGGACAAGAGCAAAGGGCAGGTGGTGCTGGC
CACGGCCATCGAGATCTGCGTCTACCCAGCTTTCTTGTACAAAGTGGTGA
GCTCCGCCACCATGGATCTCCACCGCGGTGGAGGCCGCATCTTTTACCCA
TACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGC
AGGATCCTATCCATATGACGTTCCAGATTACGCTGCTCATGGCGGACACC
GGTCCACGTGA
MSVGCPEPEPPRSLTCCGPGTAPGPGAGVPLLTEDMQALTLRTLAASDVT
KHYELVRELGKGTYGKVDLVVYKGTGTKMALKFVNKSKTKLKNFLREVSI
TNSLSSSPFIIKVFDVVFETEDCYVFAQEYAPAGDLFDIIPPQVGLPEDT
VKRCVQQLGLALDFMHGRQLVHRDIKPENVLLFDRECRRVKLADFGMTRR
VGCRVKRVSGTIPYTAPEVCQAGRADGLAVDTGVDVWAFGVLIFCVLTGN
FPWEAASGADAFFEEFVRWQRGRLPGLPSQWRRFTEPALRMFQRLLALEP
ERRGPAKEVFRFLKHELTSELRRRPSHRARKPPGDRPPAAGPLRLEAPGP
LKRTVLTESGSGSRPAPPAVGSVPLPVPVPVPVPVPVPVPEPGLAPQGPP
GRTDGRADKSKGQVVLATAIEICVYPAFLYKVVSSATMDLHRGGGRIFYP
YDVPDYAGYPYDVPDYAGSYPYDVPDYAAHGGHRST*

Index