Stock Number Hs0522

Human Gene: NCOR2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
NCOR2 nuclear receptor corepressor 2 HGNC:7673 12q24.31 Smr X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Philippe Campeau, Univ of Montreal Novel transcript pUASgHA.attB NM_006312.5 Reference Closed

Stocks

Docking Site DGRC BDSC FBti
VK37NO84735

Sequences

DNA sequence (7545 bp) Protein sequence (2515 aa)
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCC
CCGCTACCCGCCCCACAGCCTTTCCTACCCAGTGCAGATCGCCCGGACGC
ACACGGACGTCGGGCTCCTGGAGTACCAGCACCACTCCCGCGACTATGCC
TCCCACCTGTCGCCCGGCTCCATCATCCAGCCCCAGCGGCGGAGGCCCTC
CCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAGGAGCTCCACC
TGCGGCCAGAGTCCCACTCATACCTGCCCGAGCTGGGGAAGTCAGAGATG
GAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCT
GCTGCGACCGTCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAG
ACCTCACCAAGGACCGTAGCCTGACGGGCAAGCTGGAACCGGTGTCTCCC
CCCAGCCCCCCGCACACTGACCCTGAGCTGGAGCTGGTGCCGCCACGGCT
GTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGACCGAGAGATCA
CCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTG
GAGGAGGAGGCTGCCAAGCCGCCCGAGCCTGAGAAGCCCGTGTCACCGCC
GCCCATCGAGTCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGA
ACCGGAAGAAGGCTGAAGCTGCACATCGGATTCTGGAAGGCCTGGGGCCC
CAGGTGGAGCTGCCGCTGTACAACCAGCCCTCCGACACCCGGCAGTATCA
TGAGAACATCAAAATAAACCAGGCGATGCGGAAGAAGCTAATCTTGTACT
TCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCAG
CGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGA
GAACAACCCCCGGCGGCGGGCCAAGGAGAGCAAGGTGCGCGAGTACTACG
AGAAGCAGTTCCCTGAGATCCGCAAGCAGCGCGAGCTGCAGGAGCGCATG
CAGAGCAGGGTGGGCCAGCGGGGCAGTGGGCTGTCCATGTCGGCCGCCCG
CAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCAGAGCAGGAGA
ACCTGGAGAAGCAGATGCGCCAGCTGGCCGTGATCCCGCCCATGCTGTAC
GACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGC
CGACCCCATGAAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTG
AGCAGGAGAAGGAGACCTTCCGGGAGAAGTTCATGCAGCATCCCAAGAAC
TTTGGCCTGATCGCATCATTCCTGGAGAGGAAGACAGTGGCTGAGTGCGT
CCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAAGAGCCTGGTGA
GACGGAGCTATCGGCGCCGCGGCAAGAGCCAGCAGCAGCAACAACAGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCCATGCCCCGCAGCAGCCA
GGAGGAGAAAGATGAGAAGGAGAAGGAAAAGGAGGCGGAGAAGGAGGAGG
AGAAGCCGGAGGTGGAGAACGACAAGGAAGACCTCCTCAAGGAGAAGACA
GACGACACCTCAGGGGAGGACAACGACGAGAAGGAGGCTGTGGCCTCCAA
AGGCCGCAAAACTGCCAACAGCCAGGGAAGACGCAAAGGCCGCATCACCC
GCTCAATGGCTAATGAGGCCAACAGCGAGGAGGCCATCACCCCCCAGCAG
AGCGCCGAGCTGGCCTCCATGGAGCTGAATGAGAGTTCTCGCTGGACAGA
AGAAGAAATGGAAACAGCCAAGAAAGGTCTCCTGGAACACGGCCGCAACT
GGTCGGCCATCGCCCGGATGGTGGGCTCCAAGACTGTGTCGCAGTGTAAG
AACTTCTACTTCAACTACAAGAAGAGGCAGAACCTCGATGAGATCTTGCA
GCAGCACAAGCTGAAGATGGAGAAGGAGAGGAACGCGCGGAGGAAGAAGA
AGAAAGCGCCGGCGGCGGCCAGCGAGGAGGCTGCATTCCCGCCCGTGGTG
GAGGATGAGGAGATGGAGGCGTCGGGCGTGAGCGGAAATGAGGAGGAGAT
GGTGGAGGAGGCTGAAGCCTTACATGCCTCTGGGAATGAGGTGCCCAGAG
GGGAATGCAGTGGCCCAGCCACTGTCAACAACAGCTCAGACACCGAGAGC
ATCCCCTCTCCTCACACTGAGGCCGCCAAGGACACAGGGCAGAATGGGCC
CAAGCCCCCAGCCACCCTGGGCGCCGACGGGCCACCCCCAGGGCCACCCA
CCCCACCACCGGAGGACATCCCGGCCCCCACTGAGCCCACCCCGGCCTCT
GAAGCCACCGGAGCCCCTACGCCCCCACCAGCACCCCCATCGCCCTCTGC
ACCTCCTCCTGTGGTCCCCAAGGAGGAGAAGGAGGAGGAGACCGCAGCAG
CGCCCCCAGTGGAGGAGGGGGAGGAGCAGAAGCCCCCCGCGGCTGAGGAG
CTGGCAGTGGACACAGGGAAGGCCGAGGAGCCCGTCAAGAGCGAGTGCAC
GGAGGAAGCCGAGGAGGGGCCGGCCAAGGGCAAGGACGCGGAGGCCGCTG
AGGCCACGGCCGAGGGGGCGCTCAAGGCAGAGAAGAAGGAGGGCGGGAGC
GGCAGGGCCACCACAGCCAAGAGCTCGGGCGCCCCCCAGGACAGCGACTC
CAGTGCTACCTGCAGTGCAGACGAGGTGGATGAGGCCGAGGGCGGCGACA
AGAACCGGCTGCTGTCCCCAAGGCCCAGCCTCCTCACCCCGACTGGCGAC
CCCCGGGCCAATGCCTCACCCCAGAAGCCACTGGACCTGAAGCAGCTGAA
GCAGCGAGCGGCTGCCATCCCCCCCATCCAGGTCACCAAAGTCCATGAGC
CCCCCCGGGAGGACGCAGCTCCCACCAAGCCAGCTCCCCCAGCCCCACCG
CCACCGCAAAACCTGCAGCCGGAGAGCGACGCCCCTCAGCAGCCTGGCAG
CAGCCCCCGGGGCAAGAGCAGGAGCCCGGCACCCCCCGCCGACAAGGAGG
CCTTCGCAGCCGAGGCCCAGAAGCTGCCTGGGGACCCCCCTTGCTGGACT
TCCGGCCTGCCCTTCCCCGTGCCCCCCCGTGAGGTGATCAAGGCCTCCCC
GCATGCCCCGGACCCCTCAGCCTTCTCCTACGCTCCACCTGGTCACCCAC
TGCCCCTGGGCCTCCATGACACTGCCCGGCCCGTCCTGCCGCGCCCACCC
ACCATCTCCAACCCGCCTCCCCTCATCTCCTCTGCCAAGCACCCCAGCGT
CCTCGAGAGGCAAATAGGTGCCATCTCCCAAGGAATGTCGGTCCAGCTCC
ACGTCCCGTACTCAGAGCATGCCAAGGCCCCGGTGGGCCCTGTCACCATG
GGGCTGCCCCTGCCCATGGACCCCAAAAAGCTGGCACCCTTCAGCGGAGT
GAAGCAGGAGCAGCTGTCCCCACGGGGCCAGGCTGGGCCACCGGAGAGCC
TGGGGGTGCCCACAGCCCAGGAGGCGTCCGTGCTGAGAGGGACAGCTCTG
GGCTCAGTTCCGGGCGGAAGCATCACCAAAGGCATTCCCAGCACACGGGT
GCCCTCGGACAGCGCCATCACATACCGCGGCTCCATCACCCACGGCACGC
CAGCTGACGTCCTGTACAAGGGCACCATCACCAGGATCATCGGCGAGGAC
AGCCCGAGTCGCTTGGACCGCGGCCGGGAGGACAGCCTGCCCAAGGGCCA
CGTCATCTACGAAGGCAAGAAGGGCCACGTCTTGTCCTATGAGGGTGGCA
TGTCTGTGACCCAGTGCTCCAAGGAGGACGGCAGAAGCAGCTCAGGACCC
CCCCATGAGACGGCCGCCCCCAAGCGCACCTATGACATGATGGAGGGCCG
CGTGGGCAGAGCCATCTCCTCAGCCAGCATCGAAGGTCTCATGGGCCGTG
CCATCCCGCCGGAGCGACACAGCCCCCACCACCTCAAAGAGCAGCACCAC
ATCCGCGGGTCCATCACACAAGGGATCCCTCGGTCCTACGTGGAGGCACA
GGAGGACTACCTGCGTCGGGAGGCCAAGCTCCTAAAGCGGGAGGGCACGC
CTCCGCCCCCACCGCCCTCACGGGACCTGACCGAGGCCTACAAGACGCAG
GCCCTGGGCCCCCTGAAGCTGAAGCCGGCCCATGAGGGCCTGGTGGCCAC
GGTGAAGGAGGCGGGCCGCTCCATCCATGAGATCCCGCGCGAGGAGCTGC
GGCACACGCCCGAGCTGCCCCTGGCCCCGCGGCCGCTCAAGGAGGGCTCC
ATCACGCAGGGCACCCCGCTCAAGTACGACACCGGCGCGTCCACCACTGG
CTCCAAAAAGCACGACGTACGCTCCCTCATCGGCAGCCCCGGCCGGACGT
TCCCACCCGTGCACCCGCTGGATGTGATGGCCGACGCCCGGGCACTGGAA
CGTGCCTGCTACGAGGAGAGCCTGAAGAGCCGGCCAGGGACCGCCAGCAG
CTCGGGGGGCTCCATTGCGCGCGGCGCCCCGGTCATTGTGCCTGAGCTGG
GTAAGCCGCGGCAGAGCCCCCTGACCTATGAGGACCACGGGGCACCCTTT
GCCGGCCACCTCCCACGAGGTTCGCCCGTGACCACGCGGGAGCCCACGCC
GCGCCTGCAGGAGGGCAGCCTTTCGTCCAGCAAGGCATCCCAGGACCGAA
AGCTGACGTCGACGCCTCGTGAGATCGCCAAGTCCCCGCACAGCACCGTG
CCCGAGCACCACCCACACCCCATCTCGCCCTATGAGCACCTGCTTCGGGG
CGTGAGTGGCGTGGACCTGTATCGCAGCCACATCCCCCTGGCCTTCGACC
CCACCTCCATACCCCGCGGCATCCCTCTGGACGCAGCCGCTGCCTACTAC
CTGCCCCGACACCTGGCCCCCAACCCCACCTACCCGCACCTGTACCCACC
CTACCTCATCCGCGGCTACCCCGACACGGCGGCGCTGGAGAACCGGCAGA
CCATCATCAATGACTACATCACCTCGCAGCAGATGCACCACAACGCGGCC
ACCGCCATGGCCCAGCGAGCTGATATGCTGAGGGGCCTCTCGCCCCGCGA
GTCCTCGCTGGCACTCAACTACGCTGCGGGTCCCCGAGGCATCATCGACC
TGTCCCAAGTGCCACACCTGCCTGTGCTCGTGCCCCCGACACCAGGCACC
CCAGCCACCGCCATGGACCGCCTTGCCTACCTCCCCACCGCGCCCCAGCC
CTTCAGCAGCCGCCACAGCAGCTCCCCACTCTCCCCAGGAGGTCCAACAC
ACTTGACAAAACCAACCACCACGTCCTCGTCCGAGCGGGAGCGAGACCGG
GATCGAGAGCGGGACCGGGATCGGGAGCGGGAAAAGTCCATCCTCACGTC
CACCACGACGGTGGAGCACGCACCCATCTGGAGACCTGGTACAGAGCAGA
GCAGCGGCAGCAGCGGCGGGGGTGGGGGCAGCAGCAGCCGCCCCGCCTCC
CACTCCCATGCCCACCAGCACTCGCCCATCTCCCCTCGGACCCAGGATGC
CCTCCAGCAGAGACCCAGTGTGCTTCACAACACAGGCATGAAGGGTATCA
TCACCGCTGTGGAGCCCAGCACGCCCACGGTCCTGAGGTCCACCTCCACC
TCCTCACCCGTTCGCCCGGCTGCCACATTCCCACCTGCCACCCACTGCCC
ACTGGGCGGCACCCTCGATGGGGTCTACCCTACCCTCATGGAGCCCGTCT
TGCTGCCCAAGGAGGCCCCCCGGGTCGCCCGGCCAGAGCGGCCCCGAGCA
GACACCGGCCATGCCTTCCTCGCCAAGCCCCCAGCCCGCTCCGGGCTGGA
GCCCGCCTCCTCCCCCAGCAAGGGCTCGGAGCCCCGGCCCCTAGTGCCTC
CTGTCTCTGGCCACGCCACCATCGCCCGCACCCCTGCGAAGAACCTCGCA
CCTCACCACGCCAGCCCGGACCCGCCGGCGCCACCTGCCTCGGCCTCGGA
CCCGCACCGGGAAAAGACTCAAAGTAAACCCTTTTCCATCCAGGAACTGG
AACTCCGTTCTCTGGGTTACCACGGCAGCAGCTACAGCCCCGAAGGGGTG
GAGCCCGTCAGCCCTGTGAGCTCACCCAGTCTGACCCACGACAAGGGGCT
CCCCAAGCACCTGGAAGAGCTCGACAAGAGCCACCTGGAGGGGGAGCTGC
GGCCCAAGCAGCCAGGCCCCGTGAAGCTTGGCGGGGAGGCCGCCCACCTC
CCACACCTGCGGCCGCTGCCTGAGAGCCAGCCCTCGTCCAGCCCGCTGCT
CCAGACCGCCCCAGGGGTCAAAGGTCACCAGCGGGTGGTCACCCTGGCCC
AGCACATCAGTGAGGTCATCACACAGGACTACACCCGGCACCACCCACAG
CAGCTCAGCGCACCCCTGCCCGCCCCCCTCTACTCCTTCCCTGGGGCCAG
CTGCCCCGTCCTGGACCTCCGCCGCCCACCCAGTGACCTCTACCTCCCGC
CCCCGGACCATGGTGCCCCGGCCCGTGGCTCCCCCCACAGCGAAGGGGGC
AAGAGGTCTCCAGAGCCAAACAAGACGTCGGTCTTGGGTGGTGGTGAGGA
CGGTATTGAACCTGTGTCCCCACCGGAGGGCATGACGGAGCCAGGGCACT
CCCGGAGTGCTGTGTACCCGCTGCTGTACCGGGATGGGGAACAGACGGAG
CCCAGCAGGATGGGCTCCAAGTCTCCAGGCAACACCAGCCAGCCGCCAGC
CTTCTTCAGCAAGCTGACCGAGAGCAACTCCGCCATGGTCAAGTCCAAGA
AGCAAGAGATCAACAAGAAGCTGAACACCCACAACCGGAATGAGCCTGAA
TACAATATCAGCCAGCCTGGGACGGAGATCTTCAATATGCCCGCCATCAC
CGGAACAGGCCTTATGACCTATAGAAGCCAGGCGGTGCAGGAACATGCCA
GCACCAACATGGGGCTGGAGGCCATAATTAGAAAGGCACTCATGGGTAAA
TATGACCAGTGGGAAGAGTCCCCGCCGCTCAGCGCCAATGCTTTTAACCC
TCTGAATGCCAGTGCCAGCCTGCCCGCTGCTATGCCCATAACCGCTGCTG
ACGGACGGAGTGACCACACACTCACCTCGCCAGGTGGCGGCGGGAAGGCC
AAGGTCTCTGGCAGACCCAGCAGCCGAAAAGCCAAGTCCCCGGCCCCGGG
CCTGGCATCTGGGGACCGGCCACCCTCTGTCTCCTCAGTGCACTCGGAGG
GAGACTGCAACCGCCGGACGCCGCTCACCAACCGCGTGTGGGAGGACAGG
CCCTCGTCCGCAGGTTCCACGCCATTCCCCTACAACCCCCTGATCATGCG
GCTGCAGGCGGGTGTCATGGCTTCCCCACCCCCACCGGGCCTCCCCGCGG
GCAGCGGGCCCCTCGCTGGCCCCCACCACGCCTGGGACGAGGAGCCCAAG
CCACTGCTCTGCTCGCAGTACGAGACACTCTCCGACAGCGAGTGA
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYA
SHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEM
EFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSP
PSPPHTDPELELVPPRLSKEELIQNMDRVDREITMVEQQISKLKKKQQQL
EEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGP
QVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQKFCQ
RYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERM
QSRVGQRGSGLSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLY
DADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKN
FGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQQQ
QQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKT
DDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQ
SAELASMELNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCK
NFYFNYKKRQNLDEILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPVV
EDEEMEASGVSGNEEEMVEEAEALHASGNEVPRGECSGPATVNNSSDTES
IPSPHTEAAKDTGQNGPKPPATLGADGPPPGPPTPPPEDIPAPTEPTPAS
EATGAPTPPPAPPSPSAPPPVVPKEEKEEETAAAPPVEEGEEQKPPAAEE
LAVDTGKAEEPVKSECTEEAEEGPAKGKDAEAAEATAEGALKAEKKEGGS
GRATTAKSSGAPQDSDSSATCSADEVDEAEGGDKNRLLSPRPSLLTPTGD
PRANASPQKPLDLKQLKQRAAAIPPIQVTKVHEPPREDAAPTKPAPPAPP
PPQNLQPESDAPQQPGSSPRGKSRSPAPPADKEAFAAEAQKLPGDPPCWT
SGLPFPVPPREVIKASPHAPDPSAFSYAPPGHPLPLGLHDTARPVLPRPP
TISNPPPLISSAKHPSVLERQIGAISQGMSVQLHVPYSEHAKAPVGPVTM
GLPLPMDPKKLAPFSGVKQEQLSPRGQAGPPESLGVPTAQEASVLRGTAL
GSVPGGSITKGIPSTRVPSDSAITYRGSITHGTPADVLYKGTITRIIGED
SPSRLDRGREDSLPKGHVIYEGKKGHVLSYEGGMSVTQCSKEDGRSSSGP
PHETAAPKRTYDMMEGRVGRAISSASIEGLMGRAIPPERHSPHHLKEQHH
IRGSITQGIPRSYVEAQEDYLRREAKLLKREGTPPPPPPSRDLTEAYKTQ
ALGPLKLKPAHEGLVATVKEAGRSIHEIPREELRHTPELPLAPRPLKEGS
ITQGTPLKYDTGASTTGSKKHDVRSLIGSPGRTFPPVHPLDVMADARALE
RACYEESLKSRPGTASSSGGSIARGAPVIVPELGKPRQSPLTYEDHGAPF
AGHLPRGSPVTTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSTV
PEHHPHPISPYEHLLRGVSGVDLYRSHIPLAFDPTSIPRGIPLDAAAAYY
LPRHLAPNPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAA
TAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHLPVLVPPTPGT
PATAMDRLAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTSSSERERDR
DRERDRDREREKSILTSTTTVEHAPIWRPGTEQSSGSSGGGGGSSSRPAS
HSHAHQHSPISPRTQDALQQRPSVLHNTGMKGIITAVEPSTPTVLRSTST
SSPVRPAATFPPATHCPLGGTLDGVYPTLMEPVLLPKEAPRVARPERPRA
DTGHAFLAKPPARSGLEPASSPSKGSEPRPLVPPVSGHATIARTPAKNLA
PHHASPDPPAPPASASDPHREKTQSKPFSIQELELRSLGYHGSSYSPEGV
EPVSPVSSPSLTHDKGLPKHLEELDKSHLEGELRPKQPGPVKLGGEAAHL
PHLRPLPESQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQ
QLSAPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGG
KRSPEPNKTSVLGGGEDGIEPVSPPEGMTEPGHSRSAVYPLLYRDGEQTE
PSRMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPE
YNISQPGTEIFNMPAITGTGLMTYRSQAVQEHASTNMGLEAIIRKALMGK
YDQWEESPPLSANAFNPLNASASLPAAMPITAADGRSDHTLTSPGGGGKA
KVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDR
PSSAGSTPFPYNPLIMRLQAGVMASPPPPGLPAGSGPLAGPHHAWDEEPK
PLLCSQYETLSDSE*

Index