Stock Number Hs0361

Human Gene: SRBD1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SRBD1 S1 RNA binding domain 1 HGNC:25521 2p21 CG31156 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection ccsbBroadEn_12167 BC032538.1 pUASgHA.attB Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK371662572NO

Sequences

DNA sequence (2049 bp) Protein sequence (683 aa)
ATGATTGCTAAAGACAAAGACACGCTTGACTTCATTCGGAACTTGTGCCA
GAAGAGACATGTTTGTATCCAGTCATCTCTGGCAAAAGTATCCTCAAAAA
AGGTAAATGAGAAAGATGTTGATAAGTTTCTGCTCTACCAGCATTTTTCC
TGCAACATAAGAAACATTCACCATCATCAGATTCTGGCAATTAACCGTGG
AGAAAATTTGAAGGTACTGACGGTTAAGGTCAATATTTCTGATGGAGTGA
AGGATGAATTCTGTAGGTGGTGCATCCAAAACAGGTGGAGACCACGTAGC
TTTGCAAGGCCAGAGTTAATGAAGATCTTATATAATTCACTGAATGATTC
CTTTAAACGCCTTATTTATCCTCTTCTCTGTAGAGAATTCAGAGCCAAAC
TAACATCAGATGCAGAGAAGGAATCAGTAATGATGTTTGGACGGAACCTT
CGTCAGCTCCTTTTAACAAGCCCTGTTCCAGGGCGCACCTTAATGGGAGT
GGATCCTGGTTATAAACATGGTTGCAAATTAGCTATAATTTCTCCTACTA
GTCAGATACTTCATACTGATGTGGTTTACTTGCATTGTGGACAAGGCTTC
CGAGAGGCGGAGAAAATAAAGACACTTTTGCTGAATTTCAACTGCAGCAC
AGTAGTGATTGGAAATGGAACTGCCTGCAGGGAAACAGAAGCTTACTTTG
CTGACCTGATAATGAAGAATTATTTTGCACCACTGGATGTTGTTTACTGT
ATCGTCAGTGAAGCAGGAGCATCAATCTACAGTGTCAGCCCTGAAGCTAA
CAAAGAGATGCCAGGGCTGGACCCTAATTTGAGAAGTGCAGTTTCCATAG
CAAGGCGTGTACAAGATCCATTAGCTGAGCTAGTGAAAATTGAGCCAAAG
CACATTGGAGTTGGAATGTATCAGCATGACGTATCCCAGACTTTACTCAA
GGCAACACTGGACAGTGTTGTAGAAGAATGTGTCAGCTTTGTGGGAGTGG
ATATTAACATCTGTTCAGAAGTTTTGTTAAGGCATATTGCAGGACTCAAT
GCCAACAGGGCCAAAAATATTATTGAATGGCGAGAGAAAAATGGACCCTT
TATCAACCGAGAACAGCTGAAGAAAGTGAAAGGGCTGGGCCCAAAATCCT
TCCAACAGTGTGCTGGCTTCATCAGAATCAACCAGGATTATATCCGAACG
TTTTGCAGTCAGCAAACTGAAACTTCAGGCCAAATTCAAGGAGTTGCTGT
GACATCTTCAGCAGACGTTGAGGTCACAAATGAGAAGCAGGGCAAAAAGA
AGAGCAAAACTGCAGTGAATGTTTTACTGAAGCCAAATCCTTTGGACCAA
ACTTGTATTCATCCAGAATCATATGACATAGCAATGAGGTTTTTGTCATC
CATTGGAGGGACACTGTATGAGGTTGGAAAGCCTGAAATGCAACAAAAAA
TAAATTCATTCCTTGAAAAGGAAGGAATGGAGAAAATTGCAGAAAGATTG
CAAACAACAGTACACACCTTACAGGTCATCATAGATGGTCTCAGCCAGCC
TGAAAGCTTTGACTTTCGAACAGATTTTGATAAACCTGATTTCAAGAGAA
GCATAGTATGCCTGGAAGATCTGCAGATTGGGACAGTTCTTACAGGCAAA
GTTGAGAATGCCACTCTCTTTGGAATTTTTGTGGATATAGGAGTGGGGAA
ATCTGGGCTGATTCCCATACGAAATGTAACAGAAGCAAAACTTTCAAAAA
CAAAGAAGAGAAGAAGCCTTGGACTGGGCCCCGGAGAAAGAGTGGAAGTC
CAAGTACTCAACATTGACATCCCCCGATCTAGGATTACTCTGGACCTCAT
TCGGGTGTTATGCCCAACTTTCTTGTACAAAGTGGTGAGCTCCGCCACCA
TGGATCTCCACCGCGGTGGAGGCCGCATCTTTTACCCATACGATGTTCCT
GACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCC
ATATGACGTTCCAGATTACGCTGCTCATGGCGGACACCGGTCCACGTGA
MIAKDKDTLDFIRNLCQKRHVCIQSSLAKVSSKKVNEKDVDKFLLYQHFS
CNIRNIHHHQILAINRGENLKVLTVKVNISDGVKDEFCRWCIQNRWRPRS
FARPELMKILYNSLNDSFKRLIYPLLCREFRAKLTSDAEKESVMMFGRNL
RQLLLTSPVPGRTLMGVDPGYKHGCKLAIISPTSQILHTDVVYLHCGQGF
REAEKIKTLLLNFNCSTVVIGNGTACRETEAYFADLIMKNYFAPLDVVYC
IVSEAGASIYSVSPEANKEMPGLDPNLRSAVSIARRVQDPLAELVKIEPK
HIGVGMYQHDVSQTLLKATLDSVVEECVSFVGVDINICSEVLLRHIAGLN
ANRAKNIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFIRINQDYIRT
FCSQQTETSGQIQGVAVTSSADVEVTNEKQGKKKSKTAVNVLLKPNPLDQ
TCIHPESYDIAMRFLSSIGGTLYEVGKPEMQQKINSFLEKEGMEKIAERL
QTTVHTLQVIIDGLSQPESFDFRTDFDKPDFKRSIVCLEDLQIGTVLTGK
VENATLFGIFVDIGVGKSGLIPIRNVTEAKLSKTKKRRSLGLGPGERVEV
QVLNIDIPRSRITLDLIRVLCPTFLYKVVSSATMDLHRGGGRIFYPYDVP
DYAGYPYDVPDYAGSYPYDVPDYAAHGGHRST*

Index