Stock Number Hs0289

Human Gene: PTPRF


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PTPRF protein tyrosine phosphatase, receptor type F HGNC:9670 1p34.2 Lar 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Dharmacon MHS6278-202758744 Clone ID:5502598 BC048768 pUASgHA.attB NM_001329137.1 Reference Closed

Stocks

Docking Site DGRC BDSC FBti
VK331662535NO

Sequences

DNA sequence (5697 bp) Protein sequence (1899 aa)
ATGGCCCCTGAGCCAGCCCCAGGGAGGACGATGGTGCCCCTTGTGCCTGC
ACTGGTGATGCTTGGTTTGGTGGCAGGCGCCCATGGTGACAGCAAACCTG
TCTTCATTAAAGTCCCTGAGGACCAGACTGGGCTGTCAGGAGGGGTAGCC
TCCTTCGTGTGCCAAGCTACAGGAGAACCCAAGCCGCGCATCACATGGAT
GAAGAAGGGGAAGAAAGTCAGCTCCCAGCGCTTCGAGGTCATTGAGTTTG
ATGATGGGGCAGGGTCAGTGCTTCGGATCCAGCCATTGCGGGTGCAGCGA
GATGAAGCCATCTATGAGTGTACAGCTACTAACAGCCTGGGTGAGATCAA
CACTAGTGCCAAGCTCTCAGTGCTCGAAGAGGAACAGCTGCCCCCTGGGT
TCCCTTCCATCGACATGGGGCCTCAGCTGAAGGTGGTGGAGAAGGCACGC
ACAGCCACCATGCTATGTGCCGCAGGCGGAAATCCAGACCCTGAGATTTC
TTGGTTCAAGGACTTCCTTCCTGTAGACCCTGCCACGAGCAACGGCCGCA
TCAAGCAGCTGCGTTCAGGTGCCTTGCAGATAGAGAGCAGTGAGGAATCC
GACCAAGGCAAGTACGAGTGTGTGGCGACCAACTCGGCAGGCACACGTTA
CTCAGCCCCTGCGAACCTGTATGTGCGAGTGCGCCGCGTGGCTCCTCGTT
TCTCCATCCCTCCCAGCAGCCAGGAGGTGATGCCAGGCGGCAGCGTGAAC
CTGACATGCGTGGCAGTGGGTGCACCCATGCCCTACGTGAAGTGGATGAT
GGGGGCCGAGGAGCTCACCAAGGAGGATGAGATGCCAGTTGGCCGCAACG
TCCTGGAGCTCAGCAATGTCGTACGCTCTGCCAACTACACCTGTGTGGCC
ATCTCCTCGCTGGGCATGATCGAGGCCACAGCCCAGGTCACAGTGAAAGC
TCTTCCAAAGCCTCCGATTGATCTTGTGGTGACAGAGACAACTGCCACCA
GTGTCACCCTCACCTGGGACTCTGGGAACTCGGAGCCTGTAACCTACTAT
GGCATCCAGTACCGCGCAGCGGGCACGGAGGGCCCCTTTCAGGAGGTGGA
TGGTGTGGCCACCACCCGCTACAGCATTGGCGGCCTCAGCCCTTTCTCGG
AATATGCCTTCCGCGTGCTGGCGGTGAACAGCATCGGGCGAGGGCCGCCC
AGCGAGGCAGTGCGGGCACGCACGGGAGAACAGGCGCCCTCCAGCCCACC
GCGCCGCGTGCAGGCACGCATGCTGAGCGCCAGCACCATGCTGGTGCAGT
GGGAGCCTCCCGAGGAGCCCAACGGCCTGGTGCGGGGATACCGCGTCTAC
TATACTCCGGACTCCCGCCGCCCCCCGAACGCCTGGCACAAGCACAACAC
CGACGCGGGGCTCCTCACGACCGTGGGCAGCCTGCTGCCTGGCATCACCT
ACAGCCTGCGCGTGCTTGCCTTCACCGCCGTGGGCGATGGCCCTCCCAGC
CCCACCATCCAGGTCAAGACGCAGCAGGGAGTGCCTGCCCAGCCCGCGGA
CTTCCAGGCCGAGGTGGAGTCGGACACCAGGATCCAGCTCTCGTGGCTGC
TGCCCCCTCAGGAGCGGATCATCATGTATGAACTGGTGTACTGGGCGGCA
GAGGACGAAGACCAACAGCACAAGGTGACCTTCGACCCAACCTCCTCCTA
CACACTAGAGGACCTGAAGCCTGACACACTCTACCGCTTCCAGCTGGCTG
CACGCTCGGATATGGGGGTGGGCGTCTTCACCCCCACCATTGAGGCCCGC
ACAGCCCAGTCCACCCCCTCCGCCCCTCCCCAGAAGGTGATGTGTGTGAG
CATGGGCTCCACCACGGTCCGGGTAAGTTGGGTCCCGCCGCCTGCCGACA
GCCGCAACGGCGTTATCACCCAGTACTCCGTGGCCTACGAGGCGGTGGAC
GGCGAGGACCGCGGGCGGCATGTGGTGGATGGCATCAGCCGTGAGCACTC
CAGCTGGGACCTGGTGGGCCTGGAGAAGTGGACGGAGTACCGGGTGTGGG
TGCGGGCACACACAGACGTGGGCCCCGGCCCCGAGAGCAGCCCGGTGCTG
GTGCGCACCGATGAGGACGTGCCCAGCGGGCCTCCGCGGAAGGTGGAGGT
GGAGCCACTGAACTCCACTGCTGTGCATGTCTACTGGAAGCTGCCTGTCC
CCAGCAAGCAGCATGGCCAGATCCGCGGCTACCAGGTCACCTACGTGCGG
CTGGAGAATGGCGAGCCCCGTGGACTCCCCATCATCCAAGACGTCATGCT
AGCCGAGGCCCAGGAAACCACTATCAGCGGCCTGACCCCGGAGACCACCT
ACTCCGTTACTGTTGCTGCCTATACCACCAAGGGGGATGGTGCCCGCAGC
AAGCCCAAAATTGTCACTACAACAGGTGCAGTCCCAGGCCGGCCCACCAT
GATGATCAGCACCACGGCCATGAACACTGCGCTGCTCCAGTGGCACCCAC
CCAAGGAACTGCCTGGCGAGCTGCTGGGCTACCGGCTGCAGTACTGCCGG
GCCGACGAGGCGCGGCCCAACACCATAGATTTCGGCAAGGATGACCAGCA
CTTCACAGTCACCGGCCTGCACAAGGGGACCACCTACATCTTCCGGCTTG
CTGCCAAGAACCGGGCTGGCTTGGGTGAGGAGTTCGAGAAGGAGATCAGG
ACCCCCGAGGACCTGCCCAGCGGCTTCCCCCAAAACCTGCATGTGACAGG
ACTGACCACGTCTACCACAGAACTGGCCTGGGACCCGCCAGTGCTGGCGG
AGAGGAACGGGCGCATCATCAGCTACACCGTGGTGTTCCGAGACATCAAC
AGCCAACAGGAGCTGCAGAACATCACGACAGACACCCGCTTTACCCTTAC
TGGCCTCAAGCCAGACACCACTTACGACATCAAGGTCCGCGCATGGACCA
GCAAAGGCTCTGGCCCACTCAGCCCCAGCATCCAGTCCCGGACCATGCCG
GTGGAGCAAGTGTTTGCCAAGAACTTCCGGGTGGCGGCTGCAATGAAGAC
GTCTGTGCTGCTCAGCTGGGAGGTTCCCGACTCCTATAAGTCAGCTGTGC
CCTTTAAGATTCTGTACAATGGGCAGAGTGTGGAGGTGGACGGGCACTCG
ATGCGGAAGCTGATCGCAGACCTGCAGCCCAACACAGAGTACTCGTTTGT
GCTGATGAACCGTGGCAGCAGCGCAGGGGGCCTGCAGCACCTGGTGTCCA
TCCGCACAGCCCCCGACCTCCTGCCTCACAAGCCGCTGCCTGCCTCTGCC
TACATAGAGGACGGCCGCTTCGATCTCTCCATGCCCCATGTGCAAGACCC
CTCGCTTGTCAGGTGGTTCTACATTGTTGTGGTGCCCATTGACCGTGTGG
GCGGGAGCATGCTGACGCCAAGGTGGAGCACACCCGAGGAACTGGAGCTG
GACGAGCTTCTAGAAGCCATCGAGCAAGGCGGAGAGGAGCAGCGGCGGCG
GCGGCGGCAGGCAGAACGTCTGAAGCCATATGTGGCTGCTCAACTGGATG
TGCTCCCGGAGACCTTTACCTTGGGGGACAAGAAGAACTACCGGGGCTTC
TACAACCGGCCCCTGTCTCCGGACTTGAGCTACCAGTGCTTTGTGCTTGC
CTCCTTGAAGGAACCCATGGACCAGAAGCGCTATGCCTCCAGCCCCTACT
CGGATGAGATCGTGGTCCAGGTGACACCAGCCCAGCAGCAGGAGGAGCCG
GAGATGCTGTGGGTGACGGGTCCCGTGCTGGCAGTCATCCTCATCATCCT
CATTGTCATCGCCATCCTCTTGTTCAAAAGGAAAAGGACCCACTCTCCGT
CCTCTAAGGATGAGCAGTCGATCGGACTGAAGGACTCCTTGCTGGCCCAC
TCCTCTGACCCTGTGGAGATGCGGAGGCTCAACTACCAGACCCCAGGTAT
GCGAGACCACCCACCCATCCCCATCACCGACCTGGCGGACAACATCGAGC
GCCTCAAAGCCAACGATGGCCTCAAGTTCTCCCAGGAGTATGAGTCCATC
GACCCTGGACAGCAGTTCACGTGGGAGAATTCAAACCTGGAGGTGAACAA
GCCCAAGAACCGCTATGCGAATGTCATCGCCTACGACCACTCTCGAGTCA
TCCTTACCTCTATCGATGGCGTCCCCGGGAGTGACTACATCAATGCCAAC
TACATCGATGGCTACCGCAAGCAGAATGCCTACACCGCCACGCAGGGCCC
CCTGCCCGAGACCATGGGTGATTTCTGGAGGATGGTGTGGGAACAGCGCA
CGGCCACTGTGGTCATGATGACACGGCTGGAGGAGAAGTCCCGGGTAAAA
TGTGATCAGTACTGGCCAGCCCGTGGCACCGAGACCTGTGGCCTTATTCA
GGTGACCCTGTTGGACACAGTGGAGCTGGCCACATACACTGTGCGCACCT
TCGCACTCCACAAGAGTGGCTCCAGTGAGAAGCGCGAGCTGCGTCAGTTT
CAGTTCATGGCCTGGCCAGACCATGGAGTTCCTGAGTACCCAACTCCCAT
CCTGGCCTTCCTACGACGGGTCAAGGCCTGCAACCCCCTAGACGCAGGGC
CCATGGTGGTGCACTGCAGCGCGGGCGTGGGCCGCACCGGCTGCTTCATC
GTGATTGATGCCATGTTGGAGCGGATGAAGCACGAGAAGACGGTGGACAT
CTATGGCCACGTGACCTGCATGCGATCACAGAGGAACTACATGGTGCAGA
CGGAGGACCAGTACGTGTTCATCCATGAGGCGCTGCTGGAGGCTGCCACG
TGCGGCCACACAGAGGTGCCTGCCCGCAACCTGTATGCCCACATCCAGAA
GCTGGGCCAAGTGCCTCCAGGGGAGAGTGTGACCGCCATGGAGCTCGAGT
TCAAGTTGCTGGCCAGCTCCAAGGCCCACACGTCCCGCTTCATCAGCGCC
AACCTGCCCTGCAACAAGTTCAAGAACCGGCTGGTGAACATCATGCCCTA
CGAATTGACCCGTGTGTGTCTGCAGCCCATCCGTGGTGTGGAGGGCTCTG
ACTACATCAATGCCAGCTTCCTGGATGGTTATAGACAGCAGAAGGCCTAC
ATAGCTACACAGGGGCCTCTGGCAGAGAGCACCGAGGACTTCTGGCGCAT
GCTATGGGAGCACAATTCCACCATCATCGTCATGCTGACCAAGCTTCGGG
AGATGGGCAGGGAGAAATGCCACCAGTACTGGCCAGCAGAGCGCTCTGCT
CGCTACCAGTACTTTGTTGTTGACCCGATGGCTGAGTACAACATGCCCCA
GTATATCCTGCGTGAGTTCAAGGTCACGGATGCCCGGGATGGGCAGTCAA
GGACAATCCGGCAGTTCCAGTTCACAGACTGGCCAGAGCAGGGCGTGCCC
AAGACAGGCGAGGGATTCATTGACTTCATCGGGCAGGTGCATAAGACCAA
GGAGCAGTTTGGACAGGATGGGCCTATCACGGTGCACTGCAGTGCTGGCG
TGGGCCGCACCGGGGTGTTCATCACTCTGAGCATCGTCCTGGAGCGCATG
CGCTACGAGGGCGTGGTCGACATGTTTCAGACCGTGAAGACCCTGCGTAC
ACAGCGTCCTGCCATGGTGCAGACAGAGGACCAGTATCAGCTGTGCTACC
GTGCGGCCCTGGAGTACCTCGGCAGCTTTGACCACTATGCAACGTAG
MAPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFIKVPEDQTGLSGGVA
SFVCQATGEPKPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQR
DEAIYECTATNSLGEINTSAKLSVLEEEQLPPGFPSIDMGPQLKVVEKAR
TATMLCAAGGNPDPEISWFKDFLPVDPATSNGRIKQLRSGALQIESSEES
DQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEVMPGGSVN
LTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVLELSNVVRSANYTCVA
ISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPVTYY
GIQYRAAGTEGPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPP
SEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVY
YTPDSRRPPNAWHKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPS
PTIQVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERIIMYELVYWAA
EDEDQQHKVTFDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEAR
TAQSTPSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVAYEAVD
GEDRGRHVVDGISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVL
VRTDEDVPSGPPRKVEVEPLNSTAVHVYWKLPVPSKQHGQIRGYQVTYVR
LENGEPRGLPIIQDVMLAEAQETTISGLTPETTYSVTVAAYTTKGDGARS
KPKIVTTTGAVPGRPTMMISTTAMNTALLQWHPPKELPGELLGYRLQYCR
ADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIR
TPEDLPSGFPQNLHVTGLTTSTTELAWDPPVLAERNGRIISYTVVFRDIN
SQQELQNITTDTRFTLTGLKPDTTYDIKVRAWTSKGSGPLSPSIQSRTMP
VEQVFAKNFRVAAAMKTSVLLSWEVPDSYKSAVPFKILYNGQSVEVDGHS
MRKLIADLQPNTEYSFVLMNRGSSAGGLQHLVSIRTAPDLLPHKPLPASA
YIEDGRFDLSMPHVQDPSLVRWFYIVVVPIDRVGGSMLTPRWSTPEELEL
DELLEAIEQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDKKNYRGF
YNRPLSPDLSYQCFVLASLKEPMDQKRYASSPYSDEIVVQVTPAQQQEEP
EMLWVTGPVLAVILIILIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAH
SSDPVEMRRLNYQTPGMRDHPPIPITDLADNIERLKANDGLKFSQEYESI
DPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINAN
YIDGYRKQNAYTATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVK
CDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGSSEKRELRQF
QFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFI
VIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAAT
CGHTEVPARNLYAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISA
NLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAY
IATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSA
RYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVP
KTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERM
RYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT*

Index