Stock Number Hs0228

Human Gene: WNT9B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
WNT9B Wnt family member 9B HGNC:12779 17q21.32 Wnt4 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection IOH39910 pUASgHA.attB Reference Closed

Stocks

Docking Site DGRC BDSC FBti
attP86FbNO84733

Sequences

DNA sequence (990 bp) Protein sequence (330 aa)
ATGCGCCCCCCGCCCGCGCTGGCCCTGGCCGGGCTCTGCCTGCTGGCGCT
GCCCGCCGCCGCCGCCTCCTACTTCGGCCTGACCGGGCGGGAAGTCCTGA
CGCCCTTCCCAGGATTGGGCACTGCGGCAGCCCCGGCACAGGGCGGGGCC
CACCTGAAGCAGTGTGACCTGCTGAAGCTGTCCCGGCGGCAGAAGCAGCT
CTGCCGGAGGGAGCCCGGCCTGGCTGAGACCCTGAGGGATGCTGCGCACC
TCGGCCTGCTTGAGTGCCAGTTTCAGTTCCGGCATGAGCGCTGGAACTGT
AGCCTGGAGGGCAGGACGGGCCTGCTCAAGAGAGGCTTCAAAGAGACAGC
TTTCCTGTACGCGGTGTCCTCTGCCGCCCTCACCCACACCCTGGCCCGGG
CCTGCAGCGCTGGGCGCATGGAGCGCTGCACCTGTGATGACTCTCCGGGG
CTGGAGAGCCGGCAGGCCTGGCAGTGGGGCGTGTGCGGTGACAACCTCAA
GTACAGCACCAAGTTTCTGAGCAACTTCCTGGGGTCCAAGAGAGGAAACA
AGGACCTGCGGGCACGGGCAGACGCCCACAATACCCACGTGGGCATCAAG
GCTGTGAAGAGTGGCCTCAGGACCACGTGTAAGTGCCATGGCGTATCAGG
CTCCTGTGCCGTGCGCACCTGCTGGAAGCAGCTCTCCCCGTTCCGTGAGA
CGGGCCAGGTGCTGAAACTGCGCTATGACTCGGCTGTCAAGGTGTCCAGT
GCCACCAATGAGGCCTTGGGCCGCCTAGAGCTGTGGGCCCCTGCCAGGCA
GGGCAGCCTCACCAAAGGCCTGGCCCCAAGGTCTGGGGACCTGGTGTACA
TGGAGGACTCACCCAGCTTCTGCCGGCCCAGCAAGTACTCACCTGGCACA
GCAGGTTGGAGTGCAGTGGCAAGATCTCAGCTCATCACAACCTCCACCTC
CCGGATTCAAGCGATTCTCCCGTCTCAGCTGCCTGAGTAA
MRPPPALALAGLCLLALPAAAASYFGLTGREVLTPFPGLGTAAAPAQGGA
HLKQCDLLKLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRHERWNC
SLEGRTGLLKRGFKETAFLYAVSSAALTHTLARACSAGRMERCTCDDSPG
LESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADAHNTHVGIK
AVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDSAVKVSS
ATNEALGRLELWAPARQGSLTKGLAPRSGDLVYMEDSPSFCRPSKYSPGT
AGWSAVARSQLITTSTSRIQAILPSQLPE*

Index