Stock Number Hs0187

Human Gene: SLC12A5


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SLC12A5 solute carrier family 12 member 5 HGNC:13818 20q13.12 kcc 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Addgene 61404 pUASgHA.attB NM_001134771.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
attP86FbNO84732

Sequences

DNA sequence (3612 bp) Protein sequence (1204 aa)
ATGAGCCGCCGCTTCACCGTGACCAGCCTGCCCCCCGCCGGCCCCGCCCG
CAGCCCCGATCCCGAGAGCCGCCGCCACAGCGTGGCCGATCCCCGCCACC
TGCCCGGCGAGGATGTTAAGGGTGATGGCAACCCCAAGGAAAGCAGTCCC
TTCATCAACAGCACCGACACAGAGAAGGGAAAGGAGTATGATGGCAAGAA
CATGGCCTTGTTTGAGGAGGAGATGGACACCAGCCCTATGGTGTCCTCCT
TGCTCAGTGGCCTGGCCAACTACACCAACCTGCCCCAGGGAAGTAGGGAG
CATGAAGAGGCAGAAAACAATGAGGGTGGAAAAAAGAAGCCGGTGCAGGC
CCCACGCATGGGCACCTTCATGGGCGTGTACCTGCCGTGCCTGCAGAACA
TCTTTGGCGTCATCCTCTTCCTGCGGCTCACCTGGGTGGTGGGCATTGCA
GGCATCATGGAGTCCTTCTGCATGGTGTTCATCTGCTGCTCCTGTACGAT
GCTCACGGCCATCTCCATGAGTGCAATTGCAACGAATGGTGTTGTGCCTG
CTGGTGGCTCCTACTACATGATTTCCAGGTCTCTGGGCCCAGAGTTTGGG
GGTGCCGTGGGCCTCTGCTTCTACCTGGGCACTACCTTTGCAGGAGCCAT
GTACATCCTGGGCACCATCGAAATCCTGCTGGCTTACCTCTTCCCAGCCA
TGGCCATCTTCAAGGCAGAAGATGCCAGTGGGGAGGCAGCAGCCATGCTG
AACAACATGCGTGTTTACGGCACCTGTGTGCTCACCTGCATGGCCACTGT
GGTGTTTGTGGGTGTCAAGTATGTCAACAAGTTTGCCCTTGTCTTCCTGG
GTTGTGTCATCCTCTCCATCCTGGCCATCTATGCTGGGGTCATCAAGTCT
GCCTTCGACCCACCCAACTTCCCGATCTGCCTCCTGGGTAACCGCACGCT
GTCTCGCCATGGCTTTGATGTCTGTGCCAAGCTGGCTTGGGAAGGAAATG
AGACGGTGACCACACGGCTATGGGGCCTTTTCTGCTCCTCTCGCTTCCTC
AACGCCACCTGTGATGAATACTTCACCCGAAACAATGTCACAGAGATCCA
GGGCATCCCTGGTGCTGCCAGTGGCCTCATCAAAGAGAACCTCTGGAGCT
CCTACCTGACCAAGGGCGTGATTGTGGAGAGGAGTGGGATGACCTCGGTG
GGCCTGGCCGATGGCACTCCTATCGACATGGACCACCCTTATGTCTTCAG
TGATATGACCTCCTACTTCACCCTGCTGGTTGGCATCTACTTCCCCTCAG
TCACAGGGATCATGGCTGGTTCTAACCGCTCTGGGGACCTGAGGGATGCC
CAGAAGTCAATCCCCACTGGCACCATCCTGGCCATCGCCACCACCTCTGC
TGTCTACATCAGCTCCGTTGTTCTGTTTGGGGCCTGCATTGAGGGGGTCG
TCCTGCGGGACAAGTTTGGCGAAGCTGTGAATGGCAACCTCGTGGTGGGC
ACTCTGGCCTGGCCATCTCCATGGGTAATTGTCATCGGATCCTTCTTCTC
CACCTGTGGGGCTGGGCTGCAGAGCCTCACGGGGGCCCCACGCCTGCTGC
AGGCCATCTCGAGGGATGGCATTGTGCCCTTCCTGCAGGTCTTTGGCCAT
GGCAAGGCCAATGGAGAGCCGACCTGGGCCCTGCTCCTGACTGCCTGCAT
CTGCGAGATTGGCATCCTCATTGCATCCCTCGACGAGGTGGCCCCCATCC
TCTCTATGTTCTTCCTGATGTGCTACATGTTTGTGAATCTGGCCTGTGCA
GTGCAGACGCTGCTGAGGACACCCAACTGGAGGCCACGCTTTCGATATTA
CCACTGGACCCTCTCCTTCCTGGGCATGAGCCTCTGCCTGGCCCTCATGT
TCATCTGCTCCTGGTATTATGCACTGGTAGCCATGCTCATTGCTGGACTC
ATCTACAAGTACATTGAGTACCGTGGGGCAGAGAAGGAGTGGGGCGATGG
GATACGAGGTCTGTCTCTCAGTGCGGCTCGCTATGCCCTCTTACGCCTGG
AGGAAGGGCCCCCACACACCAAGAACTGGAGGCCACAGCTGCTGGTGCTG
GTGCGTGTGGACCAAGACCAGAATGTGGTGCACCCCCAGCTGCTCTCACT
GACCTCCCAGCTGAAGGCAGGGAAGGGCCTGACCATCGTGGGCTCTGTCC
TTGAGGGCACCTTTCTGGAAAATCATCCACAGGCCCAGCGGGCAGAAGAG
TCTATCAGGCGCCTGATGGAGGCAGAGAAGGTGAAGGGCTTCTGCCAGGT
GGTGATCTCCTCCAACTTGCGTGATGGCGTGTCCCATCTGATCCAGTCCG
GGGGCCTCGGGGGGCTGCAGCACAACACTGTGCTTGTTGGCTGGCCCCGC
AACTGGCGCCAGAAGGAAGATCATCAGACGTGGAGGAACTTCATTGAGCT
GGTCCGGGAAACCACAGCTGGCCACTTAGCCCTGCTGGTCACCAAGAACG
TTTCCATGTTTCCTGGGAACCCTGAGCGCTTCTCTGAGGGCAGCATCGAC
GTTTGGTGGATTGTGCACGATGGAGGCATGCTCATGCTGCTGCCCTTCCT
GCTGCGGCACCACAAGGTCTGGCGGAAGTGCAAGATGCGTATCTTCACTG
TGGCCCAGATGGATGACAATAGCATCCAGATGAAGAAGGATCTGACCACA
TTTCTGTATCATTTACGCATCACTGCGGAGGTCGAGGTGGTGGAGATGCA
TGAGAGCGACATCTCAGCTTACACCTATGAGAAGACGTTGGTGATGGAGC
AGCGTTCCCAGATCCTCAAACAGATGCATTTAACCAAGAATGAGCGGGAG
CGGGAGATCCAGAGTATCACAGATGAGTCACGAGGCTCAATCCGGAGAAA
GAATCCAGCCAACACGCGGCTCCGCCTGAACGTCCCAGAAGAGACGGCTG
GTGACAGTGAAGAGAAGCCAGAGGAGGAGGTGCAGCTGATCCACGATCAG
AGTGCTCCCAGCTGCCCCAGCAGCTCCCCGTCCCCAGGGGAGGAGCCTGA
GGGGGAAGGGGAGACAGATCCGGAGAAGGTGCATCTCACCTGGACCAAGG
ACAAGTCGGTGGCAGAGAAGAATAAGGGCCCCAGTCCTGTCTCCTCTGAG
GGCATCAAGGACTTCTTCAGCATGAAGCCGGAGTGGGAGAACTTGAACCA
GTCCAACGTGCGGCGCATGCACACGGCCGTGCGGCTGAACGAGGTCATCG
TGAAGAAATCCCGGGACGCCAAGCTTGTTTTGCTCAACATGCCTGGGCCT
CCCCGCAACCGCAATGGTGATGAAAACTACATGGAGTTTCTCGAGGTCCT
CACAGAGCACCTGGACCGGGTGATGCTGGTCCGCGGTGGTGGCCGAGAGG
TCATCACCATCTACTCCTCTAGAAACCCAGCTTTCTTGTACAAAGTGGTG
AGCTCCGCCACCATGGATCTCCACCGCGGTGGAGGCCGCATCTTTTACCC
ATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATG
CAGGATCCTATCCATATGACGTTCCAGATTACGCTGCTCATGGCGGACAC
CGGTCCACGTGA
MSRRFTVTSLPPAGPARSPDPESRRHSVADPRHLPGEDVKGDGNPKESSP
FINSTDTEKGKEYDGKNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSRE
HEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGIA
GIMESFCMVFICCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFG
GAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAEDASGEAAAML
NNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKS
AFDPPNFPICLLGNRTLSRHGFDVCAKLAWEGNETVTTRLWGLFCSSRFL
NATCDEYFTRNNVTEIQGIPGAASGLIKENLWSSYLTKGVIVERSGMTSV
GLADGTPIDMDHPYVFSDMTSYFTLLVGIYFPSVTGIMAGSNRSGDLRDA
QKSIPTGTILAIATTSAVYISSVVLFGACIEGVVLRDKFGEAVNGNLVVG
TLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDGIVPFLQVFGH
GKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACA
VQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGL
IYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVL
VRVDQDQNVVHPQLLSLTSQLKAGKGLTIVGSVLEGTFLENHPQAQRAEE
SIRRLMEAEKVKGFCQVVISSNLRDGVSHLIQSGGLGGLQHNTVLVGWPR
NWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGNPERFSEGSID
VWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTT
FLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNERE
REIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQ
SAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKGPSPVSSE
GIKDFFSMKPEWENLNQSNVRRMHTAVRLNEVIVKKSRDAKLVLLNMPGP
PRNRNGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYSSRNPAFLYKVV
SSATMDLHRGGGRIFYPYDVPDYAGYPYDVPDYAGSYPYDVPDYAAHGGH
RST*

Index