Stock Number Hs0077

Human Gene: IGSF9


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
IGSF9 immunoglobulin superfamily member 9 HGNC:18132 1q23.2 tutl 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
DF/HCC DNA Resource Core HsCD00042540 BC030141 pUASgHA.attB NM_020789.3 Reference Open

Stocks

Docking Site DGRC BDSC FBti
attP86FbNO84729 FBti0210516

Sequences

DNA sequence (3681 bp) Protein sequence (1227 aa)
ATGGTGTGGTGCCTCGGCCTGGCCGTCCTCAGCCTGGTCATCAGCCAGGG
GGCTGACGGTCGAGGGAAGCCTGAGGTGGTATCGGTGGTGGGCCGGGCTG
AGGAGAGTGTGGTGCTGGGCTGTGACCTGCTGCCCCCGGCCGGCCGGCCC
CCCCTGCATGTCATCGAGTGGCTGCGCTTTGGATTCCTGCTTCCCATCTT
CATCCAGTTCGGCCTCTACTCTCCCCGAATTGACCCTGATTACGTGGGAC
GAGTCCGGCTGCAGAAGGGGGCCTCTCTCCAGATTGAGGGTCTCCGGGTG
GAAGACCAGGGCTGGTACGAGTGCCGCGTGTTCTTCCTGGACCAGCACAT
CCCTGAAGACGATTTTGCTAACGGCTCCTGGGTGCATCTGACAGTCAATT
CACCCCCTCAATTCCAGGAGACACCTCCTGCTGTGTTGGAAGTGCAGGAA
CTGGAGCCTGTGACCCTGCGTTGTGTGGCCCGTGGCAGCCCCCTGCCTCA
TGTGACGTGGAAGCTCCGAGGAAAGGACCTTGGCCAGGGCCAGGGCCAGG
TGCAAGTGCAGAACGGGACGCTGCGGATCCGCCGGGTAGAGCGAGGCAGC
TCTGGGGTCTACACCTGCCAAGCCTCCAGCACTGAGGGCAGCGCCACCCA
CGCCACCCAGCTGCTAGTGCTAGGACCCCCAGTCATCGTGGTGCCCCCCA
AGAACAGCACAGTCAATGCCTCCCAGGATGTTTCATTGGCCTGCCATGCT
GAGGCATACCCTGCTAACCTCACCTACAGCTGGTTCCAGGACAACATCAA
TGTCTTCCACATTAGCCGCCTGCAGCCCCGGGTGCAGATCCTGGTGGACG
GGAGCCTGCGGCTGCTGGCCACCCAGCCTGATGATGCCGGCTGCTACACC
TGTGTGCCCAGCAATGGCCTCCTGCATCCACCCTCAGCCTCTGCCTACCT
CACTGTGCTCTGCATGCCGGGGGTGATCCGCTGCCCGGTTCGTGCCAACC
CCCCACTGCTCTTTGTCAGCTGGACCAAGGATGGAAAGGCCCTGCAGCTG
GACAAGTTCCCTGGCTGGTCCCAGGGCACAGAAGGCTCACTGATCATCGC
CCTGGGGAACGAGGATGCCCTGGGAGAATACTCCTGCACCCCCTACAACA
GTCTTGGTACCGCCGGGCCCTCTCCTGTGACCCGCGTGCTGCTCAAGGCT
CCCCCAGCTTTTATAGAGCGGCCCAAGGAAGAATATTTCCAAGAAGTAGG
GCGGGAGCTGCTCATCCCCTGCTCCGCCCAAGGGGACCCTCCTCCTGTTG
TCTCTTGGACCAAGGTGGGCCGGGGGCTGCAAGGCCAGGCCCAGGTGGAC
AGCAACAGCAGCCTCATCCTGCGACCATTGACCAAGGAGGCCCACGGGCA
CTGGGAATGCAGTGCCAGCAATGCTGTGGCCCGAGTGGCCACCTCCACGA
ACGTCTACGTGCTGGGCACTAGCCCTCATGTTGTCACCAATGTGTCCGTG
GTGGCTTTGCCCAAGGGTGCCAATGTCTCCTGGGAGCCTGGCTTTGATGG
TGGTTATCTGCAGAGATTCAGTGTCTGGTACACCCCACTGGCCAAGCGTC
CTGACCGAATGCACCATGACTGGGTGTCCTTGGCAGTGCCTGTGGGGGCT
GCTCACCTCCTAGTGCCAGGGCTGCAGCCCCACACCCAGTACCAGTTCAG
CGTGCTAGCTCAGAACAAGCTGGGGAGTGGTCCCTTCAGCGAAATCGTCT
TGTCTGCTCCGGAAGGGCTTCCTACCACGCCAGCTGCACCCGGGCTTCCC
CCAACAGAGATACCGCCTCCCCTGTCCCCTCCGCGGGGTCTGGTGGCAGT
GAGGACACCCCGGGGGGTACTCCTGCATTGGGATCCCCCAGAGCTGGTCC
CTAAGAGACTGGATGGCTACGTCTTGGAAGGCCGGCAAGGCTCCCAGGGC
TGGGAGGTGCTGGACCCGGCTGTGGCAGGCACAGAAACAGAGCTGCTGGT
GCCAGGCCTCATCAAGGATGTTCTCTACGAGTTCCGCCTCGTGGCCTTCG
CGGGCAGCTTCGTCAGCGACCCCAGCAACACGGCCAACGTCTCCACTTCC
GGTCTGGAGGTCTACCCTTCGCGCACGCAGCTGCCGGGCCTCCTGCCTCA
GCCCGTGCTGGCCGGCGTGGTGGGCGGAGTCTGCTTTCTGGGAGTGGCCG
TCCTTGTGAGCATCCTGGCCGGCTGCCTCCTGAACCGGCGCAGGGCTGCC
CGCCGCCGCCGCAAGCGCCTCCGCCAAGATCCACCTCTTATCTTCTCTCC
GACCGGGAAGTCAGCTGCACCCTCTGCTCTGGGCTCAGGCAGTCCTGACA
GCGTGGCGAAGCTGAAGCTCCAGGGATCCCCAGTCCCCAGCCTGCGCCAG
AGTCTGCTCTGGGGGGATCCTGCCGGAACTCCCAGCCCCCACCCGGATCC
TCCATCTAGCCGGGGACCCTTACCTCTGGAGCCCATTTGCCGGGGCCCAG
ACGGGCGCTTTGTGATGGGGCCCACTGTGGCGGCCCCCCAGGAAAGGTCA
GGCCGGGAGCAGGCAGAACCTCGGACTCCAGCCCAGCGTCTGGCCCGGTC
CTTTGACTGTAGCAGCAGCAGCCCCAGTGGGGCACCCCAGCCCCTCTGCA
TTGAAGACATCAGCCCTGTGGCACCCCCTCCAGCAGCCCCACCCAGTCCC
TTGCCAGGTCCTGGACCCCTGCTCCAGTACCTGAGCCTGCCCTTCTTCCG
AGAGATGAATGTGGATGGGGACTGGCCCCCGCTTGAGGAGCCCAGCCCTG
CTGCACCCCCAGATTACATGGATACCCGGCGCTGTCCCACCTCATCTTTC
CTTCGTTCTCCAGAAACCCCTCCTGTATCCCCCAGGGAATCACTTCCTGG
GGCTGTGGTAGGGGCTGGGGCCACTGCAGAGCCCCCTTACACAGCCCTGG
CTGACTGGACACTGAGGGAGCGGCTGCTGCCAGGCCTTCTCCCTGCTGCC
CCTCGAGGCAGCCTCACCAGCCAGAGCAGCGGGCGAGGCAGCGCTTCGTT
CCTGCGGCCCCCCTCCACAGCCCCCTCTGCAGGAGGCAGCTACCTCAGCC
CTGCTCCAGGAGACACCAGCAGCTGGGCCAGTGGCCCTGAGAGATGGCCC
CGAAGGGAGCATGTGGTGACAGTCAGCAAGAGGAGGAACACATCTGTGGA
CGAGAACTATGAGTGGGACTCAGAATTCCCTGGGGACATGGAATTGCTGG
AGACTTTGCACCTGGGCTTGGCCAGCTCCCGGCTCAGACCTGAAGCTGAG
ACAGAGCTAGGTGTGAAGACTCCAGAGGAGGGCTGCCTCCTGAACACTGC
CCATGTTACTGGCCCTGAGGCCCGCTGTGCTGCCCTTCGGGAGGAATTCC
TGGCCTTCCGCCGCCGCCGAGATGCTACTAGGGCTCGGCTACCAGCCTAT
CGACAGCCAGTCCCCCACCCCGAACAGGCCACTCTGCTGTTGTACCCAGC
TTTCTTGTACAAAGTGGTGAGCTCCGCCACCATGGATCTCCACCGCGGTG
GAGGCCGCATCTTTTACCCATACGATGTTCCTGACTATGCGGGCTATCCC
TATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTA
CGCTGCTCATGGCGGACACCGGTCCACGTGA
MVWCLGLAVLSLVISQGADGRGKPEVVSVVGRAEESVVLGCDLLPPAGRP
PLHVIEWLRFGFLLPIFIQFGLYSPRIDPDYVGRVRLQKGASLQIEGLRV
EDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPPQFQETPPAVLEVQE
LEPVTLRCVARGSPLPHVTWKLRGKDLGQGQGQVQVQNGTLRIRRVERGS
SGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACHA
EAYPANLTYSWFQDNINVFHISRLQPRVQILVDGSLRLLATQPDDAGCYT
CVPSNGLLHPPSASAYLTVLCMPGVIRCPVRANPPLLFVSWTKDGKALQL
DKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKA
PPAFIERPKEEYFQEVGRELLIPCSAQGDPPPVVSWTKVGRGLQGQAQVD
SNSSLILRPLTKEAHGHWECSASNAVARVATSTNVYVLGTSPHVVTNVSV
VALPKGANVSWEPGFDGGYLQRFSVWYTPLAKRPDRMHHDWVSLAVPVGA
AHLLVPGLQPHTQYQFSVLAQNKLGSGPFSEIVLSAPEGLPTTPAAPGLP
PTEIPPPLSPPRGLVAVRTPRGVLLHWDPPELVPKRLDGYVLEGRQGSQG
WEVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSDPSNTANVSTS
GLEVYPSRTQLPGLLPQPVLAGVVGGVCFLGVAVLVSILAGCLLNRRRAA
RRRRKRLRQDPPLIFSPTGKSAAPSALGSGSPDSVAKLKLQGSPVPSLRQ
SLLWGDPAGTPSPHPDPPSSRGPLPLEPICRGPDGRFVMGPTVAAPQERS
GREQAEPRTPAQRLARSFDCSSSSPSGAPQPLCIEDISPVAPPPAAPPSP
LPGPGPLLQYLSLPFFREMNVDGDWPPLEEPSPAAPPDYMDTRRCPTSSF
LRSPETPPVSPRESLPGAVVGAGATAEPPYTALADWTLRERLLPGLLPAA
PRGSLTSQSSGRGSASFLRPPSTAPSAGGSYLSPAPGDTSSWASGPERWP
RREHVVTVSKRRNTSVDENYEWDSEFPGDMELLETLHLGLASSRLRPEAE
TELGVKTPEEGCLLNTAHVTGPEARCAALREEFLAFRRRRDATRARLPAY
RQPVPHPEQATLLLYPAFLYKVVSSATMDLHRGGGRIFYPYDVPDYAGYP
YDVPDYAGSYPYDVPDYAAHGGHRST*

Index