Stock Number Hs0052

Human Gene: CLK2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CLK2 CDC like kinase 2 HGNC:2069 1q22 Doa 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
DNASU Plasmid Repository HsCD00512535 BC014067.2 pUASgHA.attB NM_003993.2 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO84728

Sequences

DNA sequence (1683 bp) Protein sequence (561 aa)
ATGCCGCATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGCCGGGGGAG
TTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGAAGAAGTCGCT
CCTGGTCAAGTAGTAGTGACCGGACACGACGGCGTCGGCGAGAGGACAGC
TACCATGTCCGTTCTCGAAGCAGTTATGATGATCGTTCGTCCGACCGGAG
GGTGTATGACCGGCGATACTGTGGCAGCTACAGACGCAACGATTATAGCC
GGGATCGGGGAGATGCCTACTATGACACAGACTATCGGCATTCCTATGAA
TATCAGCGGGAGAACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAA
GCACAGACGGCGGAGGAGGCGCAGCCGGACATTTAGCCGCTCATCTTCGC
ACAGCAGCCGGAGAGCCAAGAGTGTAGAGGACGACGCTGAGGGCCACCTC
ATCTACCACGTCGGGGACTGGCTACAAGAGCGATATGAAATCGTTAGCAC
CTTAGGAGAGGGGACCTTCGGCCGAGTTGTACAATGTGTTGACCATCGCA
GGGGTGGGGCTCGAGTTGCCCTGAAGATCATTAAGAATGTGGAGAAGTAC
AAGGAAGCAGCTCGACTTGAGATCAACGTGCTAGAGAAAATCAATGAGAA
AGACCCTGACAACAAGAACCTCTGTGTCCAGATGTTTGACTGGTTTGACT
ACCATGGCCACATGTGTATCTCCTTTGAGCTTCTGGGCCTTAGCACCTTC
GATTTCCTCAAAGACAACAACTACCTGCCCTACCCCATCCACCAAGTGCG
CCACATGGCCTTCCAGCTGTGCCAGGCTGTCAAGTTCCTCCATGATAACA
AGCTGACACATACAGACCTCAAGCCTGAAAATATTCTGTTTGTGAATTCA
GACTATGAGCTCACCTACAACCTAGAGAAGAAGCGAGATGAGCGCAGTGT
GAAGAGCACAGCTGTGCGGGTGGTAGACTTTGGCAGTGCCACCTTTGACC
ATGAGCACCATAGCACCATTGTCTCCACTCGCCATTACCGAGCACCAGAA
GTCATCCTTGAGTTGGGCTGGTCACAGCCTTGTGATGTGTGGAGTATAGG
CTGCATCATCTTTGAATACTATGTGGGATTCACCCTCTTCCAGACCCATG
ACAACAGAGAGCATCTAGCCATGATGGAAAGGATCTTGGGTCCTATCCCT
TCCCGGATGATCCGAAAGACAAGAAAGCAGAAATATTTTTACCGGGGTCG
CCTGGATTGGGATGAGAACACATCAGCTGGGCGCTATGTTCGTGAGAACT
GCAAACCGCTGCGGCGGTATCTGACCTCAGAGGCAGAGGAACACCACCAG
CTCTTCGATCTGATTGAAAGCATGCTAGAGTATGAACCAGCTAAGCGGCT
GACCTTGGGTGAAGCCCTTCAGCATCCTTTCTTCGCCCGCCTTCGGGCTG
AGCCGCCCAACAAGTTGTGGGACTCCAGTCGGGATATCAGTCGGTACCCA
GCTTTCTTGTACAAAGTGGTGAGCTCCGCCACCATGGATCTCCACCGCGG
TGGAGGCCGCATCTTTTACCCATACGATGTTCCTGACTATGCGGGCTATC
CCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGAT
TACGCTGCTCATGGCGGACACCGGTCCACGTGA
MPHPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDS
YHVRSRSSYDDRSSDRRVYDRRYCGSYRRNDYSRDRGDAYYDTDYRHSYE
YQRENSSYRSQRSSRRKHRRRRRRSRTFSRSSSHSSRRAKSVEDDAEGHL
IYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKY
KEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTF
DFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNS
DYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPE
VILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIP
SRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEEHHQ
LFDLIESMLEYEPAKRLTLGEALQHPFFARLRAEPPNKLWDSSRDISRYP
AFLYKVVSSATMDLHRGGGRIFYPYDVPDYAGYPYDVPDYAGSYPYDVPD
YAAHGGHRST*

Index